受付番号は、【20080705173305_12305】です。


************** [align] **************

options = -align -type=protein -matrix=blosum -gapdist=8 -maxdiv=40 -outorder=aligned -gapopen=10 -gapext=0.2 -pwmatrix=blosum -pwgapopen=10 -pwgapext=0.1

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Pearson
Sequence 1: rat_myoglobin_AAH70511              154 aa
Sequence 2: mouse_myoglobin_P04247              154 aa
Sequence 3: sheep_myoglobin_P02190              154 aa
Sequence 4: harbor_seal_myoglobin_P68080        154 aa
Sequence 5: chimpanzee_myoglobin_P02145         154 aa
Sequence 6: human_myoglobin_P02144              154 aa
Sequence 7: bovine_myoglobin_P02192             154 aa
Sequence 8: Bornean_orangutan_myoglobin_P0      154 aa
Sequence 9: Atlantic_bottle-nosed_dolphin_      154 aa
Sequence 10: Red_kangaroo_myoglobin_P02194       154 aa
Sequence 11: Spot-billed_duck_Karugamo__myo      154 aa
Sequence 12: Minke_whale_myoglobin_P02179        154 aa
Sequence 13: American_alligator_myoglobin_P      154 aa
Sequence 14: Chicken_myoglobin_P02197            154 aa
Sequence 15: map_turtle_myoglobin_P02201         154 aa
Start of Pairwise alignments
Aligning...

== Aligned score is not displayed ==

Start of Multiple Alignment
There are 14 groups
Aligning...

== Aligned score is not displayed ==

Alignment Score 79721


query.aln
CLUSTAL W (1.83) multiple sequence alignment


Spot-billed_duck_Karugamo__myo      MGLSDQEWQQVLTIWGKVEADLAGHGHAVLMRLFQDHPETLDRFEKFKGL
Chicken_myoglobin_P02197            MGLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGL
rat_myoglobin_AAH70511              MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNL
mouse_myoglobin_P04247              MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNL
human_myoglobin_P02144              MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Bornean_orangutan_myoglobin_P0      MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHL
chimpanzee_myoglobin_P02145         MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Red_kangaroo_myoglobin_P02194       MGLSDGEWQLVLNIWGKVETDEGGHGKDVLIRLFKGHPETLEKFDKFKHL
sheep_myoglobin_P02190              MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHL
bovine_myoglobin_P02192             MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHL
Atlantic_bottle-nosed_dolphin_      MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHL
Minke_whale_myoglobin_P02179        MVLSDAEWHLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHL
harbor_seal_myoglobin_P68080        MGLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHL
American_alligator_myoglobin_P      MELSDQEWKHVLDIWTKVESKLPEHGHEVIIRLLQEHPETQERFEKFKHM
map_turtle_myoglobin_P02201         MGLSDDEWHHVLGIWAKVEPDLSAHGQEVIIRLFQVHPETQERFAKFKNL
                                    * *** **: **  * *** .   **: ::: *:  **** ::* *** :

Spot-billed_duck_Karugamo__myo      KTPDQMKGSEDLKKHGVTVLTQLGKILKQKGNHEAELKPLAQTHATKHKI
Chicken_myoglobin_P02197            KTPDQMKGSEDLKKHGATVLTQLGKILKQKGNHESELKPLAQTHATKHKI
rat_myoglobin_AAH70511              KSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI
mouse_myoglobin_P04247              KSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI
human_myoglobin_P02144              KSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
Bornean_orangutan_myoglobin_P0      KSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
chimpanzee_myoglobin_P02145         KSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
Red_kangaroo_myoglobin_P02194       KSEDEMKASEDLKKHGITVLTALGNILKKKGHHEAELKPLAQSHATKHKI
sheep_myoglobin_P02190              KTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKI
bovine_myoglobin_P02192             KTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKI
Atlantic_bottle-nosed_dolphin_      KTEADMKASEDLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKI
Minke_whale_myoglobin_P02179        KTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKI
harbor_seal_myoglobin_P68080        KSEDDMRRSEDLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKI
American_alligator_myoglobin_P      KTADEMKSSEKMKQHGNTVFTALGNILKQKGNHAEVLKPLAKSHALEHKI
map_turtle_myoglobin_P02201         KTIDELRSSEEVKKHGTTVLTALGRILKLKNNHEPELKPLAESHATKHKI
                                    *:  ::: **.:::** **:* ** *** *.:*   :: **::** :***

Spot-billed_duck_Karugamo__myo      PVKYLEFISEVIIKVIAEKHSADFGADSQAAMKKALELFRNDMASKYKEF
Chicken_myoglobin_P02197            PVKYLEFISEVIIKVIAEKHAADFGADSQAAMKKALELFRNDMASKYKEF
rat_myoglobin_AAH70511              PVKYLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDIAAKYKEL
mouse_myoglobin_P04247              PVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKEL
human_myoglobin_P02144              PVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL
Bornean_orangutan_myoglobin_P0      PVKYLEFISESIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL
chimpanzee_myoglobin_P02145         PVKYLEFISECIIQVLHSKHPGDFGADAQGAMNKALELFRKDMASNYKEL
Red_kangaroo_myoglobin_P02194       PVQFLEFISDAIIQVIQSKHAGNFGADAQAAMKKALELFRHDMAAKYKEF
sheep_myoglobin_P02190              PVKYLEFISDAIIHVLHAKHPSDFGADAQGAMSKALELFRNDMAAQYKVL
bovine_myoglobin_P02192             PVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVL
Atlantic_bottle-nosed_dolphin_      PIKYLEFISEAIIHVLHSRHPAEFGADAQGAMNKALELFRKDIAAKYKEL
Minke_whale_myoglobin_P02179        PIKYLEFISDAIIHVLHSRHPAEFGADAQAAMNKALELFRKDIAAKYKEL
harbor_seal_myoglobin_P68080        PIKYLEFISEAIIHVLHSKHPAEFGADAQAAMKKALELFRNDIAAKYKEL
American_alligator_myoglobin_P      PVKYLEFISEIIVKVIAEKYPADFGADSQAAMRKALELFRNDMASKYKEF
map_turtle_myoglobin_P02201         PVKYLEFICEIIVKVIAEKHPSDFGADSQAAMRKALELFRNDMASKYKEF
                                    *:::****.: *:.*:  ::..:****:*.** *******:*:*::** :

Spot-billed_duck_Karugamo__myo      GFQG
Chicken_myoglobin_P02197            GFQG
rat_myoglobin_AAH70511              GFQG
mouse_myoglobin_P04247              GFQG
human_myoglobin_P02144              GFQG
Bornean_orangutan_myoglobin_P0      GFQG
chimpanzee_myoglobin_P02145         GFQG
Red_kangaroo_myoglobin_P02194       GFQG
sheep_myoglobin_P02190              GFQG
bovine_myoglobin_P02192             GFHG
Atlantic_bottle-nosed_dolphin_      GFHG
Minke_whale_myoglobin_P02179        GFQG
harbor_seal_myoglobin_P68080        GFHG
American_alligator_myoglobin_P      GYQG
map_turtle_myoglobin_P02201         GFQG
                                    *::*


query.dnd
(
(
(
(
rat_myoglobin_AAH70511:0.03878,
mouse_myoglobin_P04247:0.03265)
:0.06950,
(
(
Spot-billed_duck_Karugamo__myo:0.02423,
Chicken_myoglobin_P02197:0.02123)
:0.07062,
(
American_alligator_myoglobin_P:0.13893,
map_turtle_myoglobin_P02201:0.09483)
:0.05114)
:0.06930)
:0.01030,
(
(
sheep_myoglobin_P02190:0.00390,
bovine_myoglobin_P02192:0.00909)
:0.07747,
(
harbor_seal_myoglobin_P68080:0.05674,
(
Atlantic_bottle-nosed_dolphin_:0.03423,
Minke_whale_myoglobin_P02179:0.05019)
:0.01469)
:0.01831)
:0.01131)
:0.00289,
(
chimpanzee_myoglobin_P02145:0.00359,
(
human_myoglobin_P02144:0.00304,
Bornean_orangutan_myoglobin_P0:0.00994)
:0.00290)
:0.05103,
Red_kangaroo_myoglobin_P02194:0.09020);


************** [tree] **************

options = -type=protein -tree -outputtree=dist -kimura -tossgaps

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Clustal
Sequence 1: Spot-billed_duck_Karugamo__myo      154 aa
Sequence 2: Chicken_myoglobin_P02197            154 aa
Sequence 3: rat_myoglobin_AAH70511              154 aa
Sequence 4: mouse_myoglobin_P04247              154 aa
Sequence 5: human_myoglobin_P02144              154 aa
Sequence 6: Bornean_orangutan_myoglobin_P0      154 aa
Sequence 7: chimpanzee_myoglobin_P02145         154 aa
Sequence 8: Red_kangaroo_myoglobin_P02194       154 aa
Sequence 9: sheep_myoglobin_P02190              154 aa
Sequence 10: bovine_myoglobin_P02192             154 aa
Sequence 11: Atlantic_bottle-nosed_dolphin_      154 aa
Sequence 12: Minke_whale_myoglobin_P02179        154 aa
Sequence 13: harbor_seal_myoglobin_P68080        154 aa
Sequence 14: American_alligator_myoglobin_P      154 aa
Sequence 15: map_turtle_myoglobin_P02201         154 aa


query.dst
    15
Spot-billed_duck_Karugamo__myo  0.000  0.047  0.329  0.309  0.309  0.319  0.309  0.300 
           0.349  0.349  0.329  0.349  0.319  0.329  0.300 
Chicken_myoglobin_P02197        0.047  0.000  0.339  0.319  0.281  0.290  0.281  0.290 
           0.339  0.339  0.339  0.349  0.319  0.349  0.309 
rat_myoglobin_AAH70511          0.329  0.339  0.000  0.075  0.192  0.200  0.192  0.253 
           0.244  0.262  0.217  0.262  0.235  0.482  0.413 
mouse_myoglobin_P04247          0.309  0.319  0.075  0.000  0.183  0.192  0.183  0.271 
           0.235  0.253  0.183  0.262  0.209  0.532  0.436 
human_myoglobin_P02144          0.309  0.281  0.192  0.183  0.000  0.013  0.007  0.159 
           0.159  0.175  0.151  0.183  0.175  0.459  0.381 
Bornean_orangutan_myoglobin_P0  0.319  0.290  0.200  0.192  0.013  0.000  0.020  0.167 
           0.167  0.183  0.159  0.192  0.183  0.459  0.381 
chimpanzee_myoglobin_P02145     0.309  0.281  0.192  0.183  0.007  0.020  0.000  0.167 
           0.151  0.167  0.143  0.175  0.167  0.459  0.381 
Red_kangaroo_myoglobin_P02194   0.300  0.290  0.253  0.271  0.159  0.167  0.167  0.000 
           0.226  0.226  0.209  0.200  0.200  0.470  0.402 
sheep_myoglobin_P02190          0.349  0.339  0.244  0.235  0.159  0.167  0.151  0.226 
           0.000  0.013  0.167  0.167  0.200  0.494  0.402 
bovine_myoglobin_P02192         0.349  0.339  0.262  0.253  0.175  0.183  0.167  0.226 
           0.013  0.000  0.167  0.167  0.183  0.494  0.402 
Atlantic_bottle-nosed_dolphin_  0.329  0.339  0.217  0.183  0.151  0.159  0.143  0.209 
           0.167  0.167  0.000  0.090  0.105  0.507  0.447 
Minke_whale_myoglobin_P02179    0.349  0.349  0.262  0.262  0.183  0.192  0.175  0.200 
           0.167  0.167  0.090  0.000  0.143  0.494  0.413 
harbor_seal_myoglobin_P68080    0.319  0.319  0.235  0.209  0.175  0.183  0.167  0.200 
           0.200  0.183  0.105  0.143  0.000  0.482  0.381 
American_alligator_myoglobin_P  0.329  0.349  0.482  0.532  0.459  0.459  0.459  0.470 
           0.494  0.494  0.507  0.494  0.482  0.000  0.281 
map_turtle_myoglobin_P02201     0.300  0.309  0.413  0.436  0.381  0.381  0.381  0.402 
           0.402  0.402  0.447  0.413  0.381  0.281  0.000 

query.ph
(
(
(
(
(
Spot-billed_duck_Karugamo__myo:0.02646,
Chicken_myoglobin_P02197:0.02050)
:0.07579,
(
American_alligator_myoglobin_P:0.17741,
map_turtle_myoglobin_P02201:0.10322)
:0.08226)
:0.10602,
Red_kangaroo_myoglobin_P02194:0.09863)
:0.01540,
(
(
sheep_myoglobin_P02190:0.00377,
bovine_myoglobin_P02192:0.00933)
:0.08921,
(
(
Atlantic_bottle-nosed_dolphin_:0.03488,
Minke_whale_myoglobin_P02179:0.05488)
:0.01792,
harbor_seal_myoglobin_P68080:0.06099)
:0.02177)
:0.01564)
:0.00209,
(
rat_myoglobin_AAH70511:0.04145,
mouse_myoglobin_P04247:0.03376)
:0.09155,
(
(
human_myoglobin_P02144:0.00235,
Bornean_orangutan_myoglobin_P0:0.01076)
:0.00369,
chimpanzee_myoglobin_P02145:0.00290)
:0.05400);