受付番号は、【20080704174327_31359】です。


[CLUSTALW SETUP (Graphical View(<= 100 sequences) | Text View(any number of sequences))]
BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= query
         (142 letters)

Database: PROTEIN: UniProt/Swiss-Prot + TREMBL + PDBSH + PRF protein
sequence database [Last update Jul/04/2008] 
           7,347,543 sequences; 2,386,632,819 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

prf|1310208A|globin I alpha,major                                      233  4e-60
tr|B1H216|B1H216_RAT Hemoglobin alpha, adult chain 1.                  233  4e-60
sp|P01946|HBA_RAT Hemoglobin subunit alpha-1/2 (Hemoglobin alpha...    233  4e-60
prf|2006316A|hemoglobin                                                231  2e-59
prf|2513356B|globin                                                    230  3e-59
prf|2513356A|globin                                                    230  3e-59
prf|752057A|hemoglobin alpha                                           216  6e-55
tr|A4ZQC9|A4ZQC9_PERMA Hemoglobin alpha subunit 2.                     201  2e-50
tr|A4ZQ90|A4ZQ90_PERMA Hemoglobin alpha subunit 2.                     200  3e-50
tr|A4ZQA9|A4ZQA9_PERMA Hemoglobin alpha subunit 2.                     200  3e-50
tr|A4ZQC3|A4ZQC3_PERMA Hemoglobin alpha subunit 2.                     199  5e-50
tr|A4ZQ87|A4ZQ87_PERMA Hemoglobin alpha subunit 2 (Hemoglobin al...    199  6e-50
tr|Q9CWS5|Q9CWS5_MOUSE ES cells cDNA, RIKEN full-length enriched...    199  8e-50
tr|A4ZQD3|A4ZQD3_PERMA Hemoglobin alpha subunit 2.                     198  8e-50
tr|A8DUV3|A8DUV3_MOUSE Alpha-globin.                                   198  8e-50
sp|P01942|HBA_MOUSE Hemoglobin subunit alpha (Hemoglobin alpha c...    198  8e-50
tr|A8DUV1|A8DUV1_MOUSE Alpha-globin.                                   198  9e-50
tr|A4ZQ93|A4ZQ93_PERMA Hemoglobin alpha subunit 2.                     198  9e-50
tr|Q61287|Q61287_MOUSE Alpha-globin.                                   198  9e-50
tr|Q91VB8|Q91VB8_MOUSE 13 days embryo liver cDNA, RIKEN full-len...    198  9e-50
tr|Q8BPF4|Q8BPF4_MOUSE 11 days embryo whole body cDNA, RIKEN ful...    197  1e-49
tr|A4ZQB9|A4ZQB9_PERMA Hemoglobin alpha subunit 2.                     197  2e-49
tr|Q9CY06|Q9CY06_MOUSE 13 days embryo liver cDNA, RIKEN full-len...    197  2e-49
tr|A4ZQD0|A4ZQD0_PERMA Hemoglobin alpha subunit 2.                     197  2e-49
tr|A4ZQG1|A4ZQG1_PERLE Hemoglobin alpha subunit 2.                     197  3e-49
tr|A4ZQD6|A4ZQD6_PERMA Hemoglobin alpha subunit 2.                     197  3e-49
tr|A4ZQD4|A4ZQD4_PERMA Hemoglobin alpha subunit 2.                     196  3e-49
tr|A4ZQ88|A4ZQ88_PERMA Hemoglobin alpha subunit 2 (Hemoglobin al...    196  4e-49
tr|A4ZQ96|A4ZQ96_PERMA Hemoglobin alpha subunit 2.                     196  4e-49
prf|0605191A|globin alpha                                              196  5e-49
prf|671051A|hemoglobin alpha                                           196  5e-49
tr|A4ZQC5|A4ZQC5_PERMA Hemoglobin alpha subunit 2.                     196  5e-49
tr|A4ZQB2|A4ZQB2_PERMA Hemoglobin alpha subunit 2.                     196  5e-49
tr|A4ZQF6|A4ZQF6_PERMA Hemoglobin alpha subunit 2.                     196  5e-49
prf|1613344A|hemoglobin alpha                                          196  6e-49
sp|P26915|HBA_NASNA Hemoglobin subunit alpha (Hemoglobin alpha c...    196  6e-49
tr|A4ZQE9|A4ZQE9_PERMA Hemoglobin alpha subunit 2.                     196  6e-49
tr|A4ZQD9|A4ZQD9_PERMA Hemoglobin alpha subunit 2.                     196  6e-49
prf|0712204A|hemoglobin alpha                                          194  1e-48
sp|P01950|HBA_SUNMU Hemoglobin subunit alpha (Hemoglobin alpha c...    194  1e-48
sp|P18969|HBA_AILFU Hemoglobin subunit alpha (Hemoglobin alpha c...    194  1e-48
tr|A4ZQB7|A4ZQB7_PERMA Hemoglobin alpha subunit 2.                     194  1e-48
tr|A4ZQ92|A4ZQ92_PERMA Hemoglobin alpha subunit 2.                     193  3e-48
prf|1309193A|hemoglobin alpha1                                         193  4e-48
sp|P11755|HBA1_TADBR Hemoglobin subunit alpha-1 (Hemoglobin alph...    193  4e-48
sp|P14387|HBA_ANTPA Hemoglobin subunit alpha (Hemoglobin alpha c...    193  4e-48
prf|0409309A|hemoglobin alpha                                          192  4e-48
sp|P01938|HBA_LORTA Hemoglobin subunit alpha (Hemoglobin alpha c...    192  5e-48
tr|A4ZQ95|A4ZQ95_PERMA Hemoglobin alpha subunit 2.                     192  5e-48
sp|P68236|HBA_URSTH Hemoglobin subunit alpha (Hemoglobin alpha c...    192  5e-48
sp|P68237|HBA_URSML Hemoglobin subunit alpha (Hemoglobin alpha c...    192  5e-48
sp|P68235|HBA_URSMA Hemoglobin subunit alpha (Hemoglobin alpha c...    192  5e-48
tr|A4ZQK9|A4ZQK9_PERMA Hemoglobin alpha subunit 1.                     192  7e-48
prf|731915A|hemoglobin alpha                                           192  7e-48
sp|P01937|HBA_NYCCO Hemoglobin subunit alpha (Hemoglobin alpha c...    192  7e-48
tr|Q63910|Q63910_RAT Alpha globin.                                     191  1e-47
sp|P18970|HBA_AILME Hemoglobin subunit alpha (Hemoglobin alpha c...    191  1e-47
prf|1703248A|hemoglobin alpha                                          191  1e-47
sp|P20854|HBA_CTEGU Hemoglobin subunit alpha (Hemoglobin alpha c...    191  1e-47
tr|Q28743|Q28743_SHEEP Alpha globin chain.                             191  2e-47
prf|0712202A|hemoglobin alpha                                          191  2e-47
sp|P01951|HBA_TALEU Hemoglobin subunit alpha (Hemoglobin alpha c...    191  2e-47
prf|1512173A|hemoglobin alpha                                          191  2e-47
sp|P15163|HBA_LEPWE Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    191  2e-47
prf|1312256A|hemoglobin alpha                                          191  2e-47
tr|A4ZQF0|A4ZQF0_PERMA Hemoglobin alpha subunit 2.                     190  2e-47
prf|1311238A|hemoglobin alpha                                          190  2e-47
prf|1203225A|hemoglobin alpha                                          190  2e-47
sp|P01928|HBA_CEBAP Hemoglobin subunit alpha (Hemoglobin alpha c...    190  3e-47
tr|A4ZQG5|A4ZQG5_PERMA Hemoglobin alpha subunit 1.                     190  3e-47
prf|0804243A|hemoglobin alpha                                          190  3e-47
sp|P01964|HBA_DASNO Hemoglobin subunit alpha (Hemoglobin alpha c...    190  3e-47
tr|A4ZQE7|A4ZQE7_PERMA Hemoglobin alpha subunit 2.                     190  3e-47
prf|1505269A|hemoglobin alpha                                          190  4e-47
sp|P10778|HBA_ODORO Hemoglobin subunit alpha (Hemoglobin alpha c...    190  4e-47
prf|1212251A|hemoglobin alpha                                          189  4e-47
sp|P09420|HBA_SPECI Hemoglobin subunit alpha (Hemoglobin alpha c...    189  4e-47
sp|P60530|HBA_CANLA Hemoglobin subunit alpha (Hemoglobin alpha c...    189  5e-47
prf|1817361A|hemoglobin                                                189  5e-47
sp|P41327|HBA_LYNLY Hemoglobin subunit alpha (Hemoglobin alpha c...    189  5e-47
sp|P01930|HBA_COLBA Hemoglobin subunit alpha (Hemoglobin alpha c...    189  5e-47
prf|0412236A|hemoglobin alpha                                          189  5e-47
sp|P18977|HBA_PROLO Hemoglobin subunit alpha (Hemoglobin alpha c...    189  5e-47
sp|P01963|HBA_CERSI Hemoglobin subunit alpha (Hemoglobin alpha c...    189  5e-47
sp|Q9XSN3|HBA1_EQUBU Hemoglobin subunit alpha-1 (Hemoglobin alph...    189  6e-47
sp|P19015|HBA_HIPAM Hemoglobin subunit alpha (Hemoglobin alpha c...    189  6e-47
sp|P01945|HBA_MESAU Hemoglobin subunit alpha (Hemoglobin alpha c...    189  6e-47
sp|P41329|HBA1_ARCGA Hemoglobin subunit alpha-1 (Hemoglobin alph...    189  7e-47
prf|1301216A|hemoglobin alpha                                          189  7e-47
sp|P09908|HBA_PHOVI Hemoglobin subunit alpha (Hemoglobin alpha c...    189  7e-47
prf|1202311A|globin alpha1                                             189  7e-47
sp|P01948|HBA_RABIT Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    189  7e-47
sp|Q9TS35|HBA1_HYLLA Hemoglobin subunit alpha-1 (Hemoglobin alph...    189  7e-47
tr|B2KHV8|B2KHV8_RHIFE Theta 1 globin (Predicted) (Hemoglobin su...    189  7e-47
tr|B1MT35|B1MT35_CALMO Theta 1 globin (Predicted) (Alpha 2 globi...    189  8e-47
sp|P67817|HBA_ATEGE Hemoglobin subunit alpha (Hemoglobin alpha c...    189  8e-47
sp|P41330|HBA2_ARCGA Hemoglobin subunit alpha-2 (Hemoglobin alph...    188  8e-47
prf|0807251B|globin alphaII                                            188  8e-47
sp|P60529|HBA_CANFA Hemoglobin subunit alpha (Hemoglobin alpha c...    188  9e-47
prf|0912206A|hemoglobin alpha                                          188  1e-46
sp|P01944|HBA_ONDZI Hemoglobin subunit alpha (Hemoglobin alpha c...    188  1e-46
tr|A4ZQJ3|A4ZQJ3_PERMA Hemoglobin alpha subunit 1.                     188  1e-46
prf|1516157A|hemoglobin alpha                                          188  1e-46
sp|P20243|HBA_MUSPF Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    188  1e-46
prf|1505266A|hemoglobin alpha                                          188  1e-46
sp|P10885|HBA_PTEBR Hemoglobin subunit alpha (Hemoglobin alpha c...    188  1e-46
prf|1109157A|hemoglobin alpha                                          188  1e-46
sp|P01958|HBA_HORSE Hemoglobin subunit alpha (Hemoglobin alpha c...    188  1e-46
sp|P07405|HBA_FELCA Hemoglobin subunit alpha (Hemoglobin alpha c...    188  1e-46
tr|Q28383|Q28383_HORSE Horse BII alpha-2 globin.                       188  1e-46
sp|P63109|HBA_PANON Hemoglobin subunit alpha (Hemoglobin alpha c...    188  1e-46
prf|1012308A|globin alpha 1BII                                         187  1e-46
sp|Q9XSE9|HBA_EQUPR Hemoglobin subunit alpha (Hemoglobin alpha c...    187  1e-46
sp|P18975|HBA_PANLE Hemoglobin subunit alpha (Hemoglobin alpha c...    187  1e-46
prf|732177A|hemoglobin alpha                                           187  1e-46
prf|1613153A|hemoglobin alpha                                          187  2e-46
sp|P17689|HBA_MARFO Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
prf|1303302A|globin                                                    187  2e-46
prf|1401172A|hemoglobin alpha                                          187  2e-46
sp|P11750|HBA_SPEPA Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
prf|1203227A|hemoglobin alpha                                          187  2e-46
sp|P07421|HBA_CEBCA Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
prf|1708165A|hemoglobin alpha                                          187  2e-46
sp|P21200|HBA_VULVU Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
tr|B0VX78|B0VX78_CALJA Theta 1 globin (Predicted).                     187  2e-46
sp|P01960|HBA_EQUZE Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
sp|P01959|HBA_EQUAS Hemoglobin subunit alpha (Hemoglobin alpha c...    187  2e-46
sp|Q7JFN6|HBA2_EQUGR Hemoglobin subunit alpha-2 (Hemoglobin alph...    187  2e-46
sp|Q9TVA3|HBA2_EQUBU Hemoglobin subunit alpha-2 (Hemoglobin alph...    187  2e-46
tr|A4ZQM1|A4ZQM1_PERMA Hemoglobin alpha subunit 1.                     187  2e-46
prf|765952A|hemoglobin alpha                                           187  2e-46
sp|P68240|HBA_SHEEP Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    187  2e-46
sp|P68238|HBA_CAPHI Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    187  2e-46
sp|P68239|HBA_AMMLE Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    187  2e-46
prf|1612429A|hemoglobin alpha                                          187  2e-46
sp|P23601|HBA_MUSPU Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    187  2e-46
tr|Q28745|Q28745_SHEEP Alpha globin chain.                             187  2e-46
sp|Q0ZA50|HBA_PANHO Hemoglobin subunit alpha (Hemoglobin alpha c...    187  3e-46
prf|0309296A|hemoglobin alpha                                          187  3e-46
sp|P01941|HBA_TUPGL Hemoglobin subunit alpha (Hemoglobin alpha c...    187  3e-46
prf|0810212A|hemoglobin alpha                                          187  3e-46
prf|742499A|hemoglobin alpha                                           187  3e-46
prf|0402268A|hemoglobin alpha                                          187  3e-46
pdb|2B7H_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    187  3e-46
pdb|2B7H_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    187  3e-46
pdb|1FHJ_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...    187  3e-46
pdb|1FHJ_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...    187  3e-46
sp|P60523|HBA_CHRBR Hemoglobin subunit alpha (Hemoglobin alpha c...    187  3e-46
prf|1301215A|hemoglobin alpha                                          187  3e-46
sp|P11757|HBA_MYOVE Hemoglobin subunit alpha (Hemoglobin alpha c...    187  3e-46
prf|2201323A|hemoglobin                                                187  3e-46
sp|Q7M2Y4|HBA_CHAMP Hemoglobin subunit alpha (Hemoglobin alpha c...    187  3e-46
sp|P01961|HBA_EQUHE Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    187  3e-46
prf|1718299A|hemoglobin                                                186  3e-46
sp|Q9XSK1|HBA4_BUBBU Hemoglobin subunit alpha-4 (Hemoglobin alph...    186  3e-46
tr|Q28744|Q28744_SHEEP Alpha globin chain.                             186  3e-46
prf|1108181A|hemoglobin alpha                                          186  3e-46
prf|1006229A|hemoglobin alpha                                          186  3e-46
sp|P01943|HBA_SPAEH Hemoglobin subunit alpha (Hemoglobin alpha c...    186  3e-46
prf|1819335A|alpha globin                                              186  4e-46
sp|P19014|HBA_CRIGA Hemoglobin subunit alpha (Hemoglobin alpha c...    186  4e-46
prf|1111202A|hemoglobin alpha                                          186  4e-46
sp|P07403|HBA_SPETO Hemoglobin subunit alpha (Hemoglobin alpha c...    186  4e-46
prf|0409270A|hemoglobin alpha                                          186  4e-46
sp|P01953|HBA_MELME Hemoglobin subunit alpha (Hemoglobin alpha c...    186  4e-46
prf|1612430A|hemoglobin alpha                                          186  4e-46
sp|P23600|HBA_MUSLU Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    186  4e-46
sp|P01939|HBA2_GALCR Hemoglobin subunit alpha-B (Hemoglobin alph...    186  4e-46
tr|A4ZQM9|A4ZQM9_PERLE Hemoglobin alpha subunit 1.                     186  4e-46
sp|Q9TSN8|HBA2_BUBBU Hemoglobin subunit alpha-2 (Hemoglobin alph...    186  4e-46
prf|711680A|hemoglobin alpha                                           186  4e-46
prf|0504211A|hemoglobin alpha                                          186  4e-46
sp|P01936|HBA_EULFU Hemoglobin subunit alpha (Hemoglobin alpha c...    186  4e-46
pdb|1S0H_A|3.00| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    186  4e-46
sp|Q9TS34|HBA2_HYLLA Hemoglobin subunit alpha-2 (Hemoglobin alph...    186  5e-46
sp|P15448|HBA_MELCA Hemoglobin subunit alpha (Hemoglobin alpha c...    186  5e-46
prf|732178A|hemoglobin alpha                                           186  5e-46
prf|1004272A|hemoglobin alpha                                          186  5e-46
sp|P67818|HBA_SAGOE Hemoglobin subunit alpha (Hemoglobin alpha c...    186  5e-46
prf|0608225A|hemoglobin alpha                                          186  6e-46
pdb|2D5X_A|1.45| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    186  6e-46
pdb|1IWH_A|1.55| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    186  6e-46
prf|0603229A|hemoglobin alpha                                          186  6e-46
sp|P63106|HBA_CAMDR Hemoglobin subunit alpha (Hemoglobin alpha c...    186  6e-46
sp|P63105|HBA_CAMBA Hemoglobin subunit alpha (Hemoglobin alpha c...    186  6e-46
sp|Q9TSN7|HBA1_BUBBU Hemoglobin subunit alpha-1 (Hemoglobin alph...    186  6e-46
prf|1614252A|hemoglobin alpha                                          186  6e-46
prf|2706289H|HBA1 gene                                                 186  6e-46
prf|2706289G|HBA2 gene                                                 186  6e-46
prf|1002273B|globin alpha                                              186  6e-46
prf|1002273A|globin alpha1                                             186  6e-46
pdb|1Z8U_D|2.40| 4| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN ...    186  6e-46
pdb|1Z8U_B|2.40| 4| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN ...    186  6e-46
pdb|1Y01_B|2.80| 2| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN ...    186  6e-46
pdb|1BZ1_C|1.59| 4| 142|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    186  6e-46
pdb|1BZ1_A|1.59| 4| 142|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    186  6e-46
tr|Q5R9M5|Q5R9M5_PONAB Putative uncharacterized protein DKFZp468...    186  6e-46
sp|P69907|HBA_PANTR Hemoglobin subunit alpha (Hemoglobin alpha c...    186  6e-46
sp|P69906|HBA_PANPA Hemoglobin subunit alpha (Hemoglobin alpha c...    186  6e-46
sp|P69905|HBA_HUMAN Hemoglobin subunit alpha (Hemoglobin alpha c...    186  6e-46
tr|Q1HDT5|Q1HDT5_HUMAN Hemoglobin alpha 1-2 hybrid.                    186  7e-46
prf|1616185A|hemoglobin alpha                                          185  7e-46
sp|P67816|HBA_LAMPA Hemoglobin subunit alpha (Hemoglobin alpha c...    185  7e-46
sp|P67815|HBA_LAMGU Hemoglobin subunit alpha (Hemoglobin alpha c...    185  7e-46
sp|P01966|HBA_BOVIN Hemoglobin subunit alpha (Hemoglobin alpha c...    185  8e-46
prf|1313206A|hemoglobin                                                185  8e-46
prf|1206295A|hemoglobin alpha                                          185  8e-46
sp|P01940|HBA_TARBA Hemoglobin subunit alpha (Hemoglobin alpha c...    185  8e-46
sp|P63110|HBA_PANPO Hemoglobin subunit alpha (Hemoglobin alpha c...    185  8e-46
prf|0901252A|hemoglobin alpha                                          185  8e-46
sp|P01956|HBA_ROUAE Hemoglobin subunit alpha (Hemoglobin alpha c...    185  8e-46
prf|1010261A|hemoglobin alphaI                                         185  8e-46
sp|P01962|HBA_TAPTE Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    185  8e-46
sp|P09423|HBA_BISBO Hemoglobin subunit alpha-I/II (Hemoglobin al...    185  8e-46
prf|1004272B|hemoglobin alpha                                          185  8e-46
sp|P18972|HBA_CALAR Hemoglobin subunit alpha (Hemoglobin alpha c...    185  8e-46
prf|1408162A|hemoglobin alpha                                          185  9e-46
prf|1305232A|hemoglobin alpha                                          185  9e-46
sp|P09839|HBA_MACCA Hemoglobin subunit alpha (Hemoglobin alpha c...    185  9e-46
sp|P10892|HBA_LUTLU Hemoglobin subunit alpha (Hemoglobin alpha c...    185  9e-46
sp|P01969|HBA_BOSGF Hemoglobin subunit alpha (Hemoglobin alpha c...    185  1e-45
sp|P01971|HBA_ALCAA Hemoglobin subunit alpha (Hemoglobin alpha c...    185  1e-45
prf|1104186A|hemoglobin alphaI                                         185  1e-45
prf|0803202A|hemoglobin alpha                                          185  1e-45
prf|3324415A|Hb                                                        185  1e-45
tr|A4GTS5|A4GTS5_OCHCU Hemoglobin alpha chain.                         185  1e-45
prf|0807251A|globin alphaI                                             185  1e-45
prf|1204171A|hemoglobin alpha                                          184  1e-45
sp|P08852|HBA_MARMA Hemoglobin subunit alpha (Hemoglobin alpha c...    184  1e-45
tr|A4ZQK3|A4ZQK3_PERMA Hemoglobin alpha subunit 1.                     184  1e-45
prf|0803202B|hemoglobin alphaI                                         184  1e-45
sp|P01947|HBA_CAVPO Hemoglobin subunit alpha (Hemoglobin alpha c...    184  1e-45
sp|P06635|HBA_PONPY Hemoglobin subunit alpha (Hemoglobin alpha c...    184  1e-45
prf|1004268A|hemoglobin alphaI                                         184  2e-45
sp|P01967|HBA1_BOSMU Hemoglobin subunit alpha-1 (Hemoglobin alph...    184  2e-45
tr|A4ZQH1|A4ZQH1_PERMA Hemoglobin alpha subunit 1.                     184  2e-45
tr|Q4TU70|Q4TU70_CEREL Alpha hemoglobin chain.                         184  2e-45
prf|1414222A|hemoglobin alpha                                          184  2e-45
prf|1306240A|hemoglobin alpha                                          184  2e-45
sp|P09906|HBA_RHIUN Hemoglobin subunit alpha (Hemoglobin alpha c...    184  2e-45
prf|671052A|hemoglobin alpha                                           184  2e-45
prf|1501424A|hemoglobin alpha                                          184  2e-45
sp|P18976|HBA_PANPS Hemoglobin subunit alpha (Hemoglobin alpha c...    184  2e-45
sp|P63108|HBA_MACMU Hemoglobin subunit alpha (Hemoglobin alpha c...    184  2e-45
sp|P63107|HBA_MACFU Hemoglobin subunit alpha (Hemoglobin alpha c...    184  2e-45
tr|A4ZQL1|A4ZQL1_PERMA Hemoglobin alpha subunit 1.                     184  2e-45
prf|1001193A|globin alpha                                              183  3e-45
pdb|2MHB_A|2.0 | 2| 141|N|HEMOGLOBIN (HORSE, AQUO MET)          ...    183  3e-45
pdb|2DHB_A|2.8 | 2| 141|N|HEMOGLOBIN (HORSE,DEOXY)              ...    183  3e-45
pdb|1Y8K_C|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y8K_A|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y8I_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y8I_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y8H_C|3.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y8H_A|3.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NS9_A|1.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NS6_A|2.05| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1G0B_A|1.90| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1O1P_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1C7C_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN (...    183  3e-45
pdb|1ABY_A|2.6 | 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1ABW_A|2.0 | 5| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN-BASED ...    183  3e-45
pdb|1C7D_A|1.80| 3| 284|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN (...    183  3e-45
prf|0502223A|hemoglobin alpha                                          183  3e-45
sp|P01949|HBA_ERIEU Hemoglobin subunit alpha (Hemoglobin alpha c...    183  3e-45
prf|0404172A|hemoglobin alpha                                          183  3e-45
pdb|2PGH_C|2.8 | 4| 141|N|HEMOGLOBIN (AQUOMET)                  ...    183  3e-45
pdb|2PGH_A|2.8 | 4| 141|N|HEMOGLOBIN (AQUOMET)                  ...    183  3e-45
pdb|1QPW_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOB...    183  3e-45
pdb|1QPW_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOB...    183  3e-45
sp|P01965|HBA_PIG Hemoglobin subunit alpha (Hemoglobin alpha cha...    183  3e-45
prf|1819219A|hemoglobin                                                183  3e-45
sp|P28780|HBA_TAPGE Hemoglobin subunit alpha (Hemoglobin alpha c...    183  3e-45
prf|650772A|hemoglobin alpha                                           183  3e-45
prf|620479A|hemoglobin alpha                                           183  3e-45
prf|2010369A|hemoglobin                                                183  3e-45
prf|0907233A|hemoglobin alpha                                          183  3e-45
prf|0703294A|globin alpha 5'                                           183  3e-45
pdb|6HBW_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: PROTEIN (HEMOGLOB...    183  3e-45
pdb|6HBW_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: PROTEIN (HEMOGLOB...    183  3e-45
pdb|4HHB_C|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  3e-45
pdb|4HHB_A|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  3e-45
pdb|3HHB_A|1.74| 2| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  3e-45
pdb|2HHE_C|2.2 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL B 1...    183  3e-45
pdb|2HHE_A|2.2 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL B 1...    183  3e-45
pdb|2HHD_C|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY) (HBA)              ...    183  3e-45
pdb|2HHD_A|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY) (HBA)              ...    183  3e-45
pdb|2HHB_C|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  3e-45
pdb|2HHB_A|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  3e-45
pdb|2HCO_A|2.7 | 2| 141|N|HEMOGLOBIN (CARBONMONOXY)             ...    183  3e-45
pdb|2HBS_G|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHA...    183  3e-45
pdb|2HBS_E|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHA...    183  3e-45
pdb|2HBS_C|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHA...    183  3e-45
pdb|2HBS_A|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHA...    183  3e-45
pdb|2HBF_A|2.2 | 2| 141|N|HEMOGLOBIN A (N-PROPYL ISCOCYANIDE, PH...    183  3e-45
pdb|2HBE_A|2.0 | 2| 141|N|HEMOGLOBIN A (N-BUTYL ISCOCYANIDE, PH ...    183  3e-45
pdb|2HBD_A|2.2 | 2| 141|N|HEMOGLOBIN A (METHYL ISCOCYANIDE, PH 6...    183  3e-45
pdb|2HBC_A|2.1 | 2| 141|N|HEMOGLOBIN A (ETHYL ISCOCYANIDE, PH 6....    183  3e-45
pdb|2H35_C|NOT | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2H35_A|NOT | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2DN3_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2DN2_C|1.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2DN2_A|1.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2DN1_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2D60_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2D60_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2D5Z_C|1.45| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|2D5Z_A|1.45| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YZI_A|2.07| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YVT_A|1.80| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YVQ_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YVQ_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YIH_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YIH_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YIE_C|2.40| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YIE_A|2.40| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YHR_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YHR_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YHE_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YHE_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YH9_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YH9_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YGF_C|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YGF_A|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YGD_C|2.73| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YGD_A|2.73| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YG5_C|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YG5_A|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YFF_G|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YFF_E|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YFF_C|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YFF_A|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEV_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEV_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEU_C|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEU_A|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEQ_C|2.75| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEQ_A|2.75| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEO_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEO_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEN_C|2.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YEN_A|2.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE2_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE2_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE1_C|4.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE1_A|4.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE0_C|2.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1YE0_A|2.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y85_C|2.13| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y85_A|2.13| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y83_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y83_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7Z_C|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7Z_A|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7G_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7G_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7D_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7D_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7C_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y7C_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5K_C|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5K_A|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5J_C|2.03| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5J_A|2.03| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5F_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y5F_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4V_C|1.84| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4V_A|1.84| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4R_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4R_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4Q_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4Q_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4P_C|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4P_A|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4G_C|1.91| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4G_A|1.91| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4F_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4F_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4B_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y4B_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y46_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y46_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y45_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y45_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y35_C|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y35_A|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y31_C|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y31_A|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y2Z_C|2.07| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y2Z_A|2.07| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y22_C|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y22_A|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y0W_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y0W_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y0T_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1Y0T_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1XZ2_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1XZ2_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1XXT_C|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1XXT_A|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1UIW_G|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1UIW_E|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1UIW_C|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1UIW_A|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1THB_C|1.5 | 4| 141|N|HEMOGLOBIN (T STATE, PARTIALLY OXYGENA...    183  3e-45
pdb|1THB_A|1.5 | 4| 141|N|HEMOGLOBIN (T STATE, PARTIALLY OXYGENA...    183  3e-45
pdb|1SI4_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1SI4_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1SHR_C|1.88| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1SHR_A|1.88| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1SDL_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1SDL_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1SDK_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1SDK_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1RQA_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RQA_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RQ4_C|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RQ4_A|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RQ3_C|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RQ3_A|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RPS_C|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1RPS_A|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QXE_C|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QXE_A|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QXD_C|2.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QXD_A|2.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QSI_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QSI_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QSH_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1QSH_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NQP_C|1.73| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NQP_A|1.73| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NIH_C|2.6 | 4| 141|N|ALPHA-NICKELOUS, BETA-FERROUS CARBONMO...    183  3e-45
pdb|1NIH_A|2.6 | 4| 141|N|ALPHA-NICKELOUS, BETA-FERROUS CARBONMO...    183  3e-45
pdb|1NEJ_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1NEJ_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1MKO_C|2.18| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1MKO_A|2.18| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1M9P_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1M9P_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LJW_A|2.16| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFZ_A|3.10| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFY_A|3.30| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFV_A|2.80| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFT_A|2.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFQ_A|2.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFL_R|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFL_P|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFL_C|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1LFL_A|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1KD2_C|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1KD2_A|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1K1K_A|2.00| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1K0Y_C|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1K0Y_A|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_W|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_U|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_R|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_P|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_C|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1JY7_A|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J41_G|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J41_E|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J41_C|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J41_A|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J40_G|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J40_E|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J40_C|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J40_A|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Z_G|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Z_E|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Z_C|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Z_A|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Y_G|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Y_E|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Y_C|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1J3Y_A|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1IRD_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1HHO_A|2.1 | 2| 141|N|HEMOGLOBIN A (OXY)                    ...    183  3e-45
pdb|1HGC_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, ALPHA-OXY)       ...    183  3e-45
pdb|1HGC_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, ALPHA-OXY)       ...    183  3e-45
pdb|1HGB_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, AQUOMET)         ...    183  3e-45
pdb|1HGB_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, AQUOMET)         ...    183  3e-45
pdb|1HGA_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, DEOXYGENATED)    ...    183  3e-45
pdb|1HGA_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, DEOXYGENATED)    ...    183  3e-45
pdb|1HDB_C|2.2 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY...    183  3e-45
pdb|1HDB_A|2.2 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY...    183  3e-45
pdb|1HCO_A|2.7 | 2| 141|N|HEMOGLOBIN (CARBONMONOXY)             ...    183  3e-45
pdb|1HBS_G|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                  ...    183  3e-45
pdb|1HBS_E|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                  ...    183  3e-45
pdb|1HBS_C|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                  ...    183  3e-45
pdb|1HBS_A|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                  ...    183  3e-45
pdb|1HBB_C|1.9 | 4| 141|N|HEMOGLOBIN A (DEOXY, LOW SALT, 100MM C...    183  3e-45
pdb|1HBB_A|1.9 | 4| 141|N|HEMOGLOBIN A (DEOXY, LOW SALT, 100MM C...    183  3e-45
pdb|1HBA_C|2.1 | 4| 141|N|HEMOGLOBIN ROTHSCHILD (DEOXY)         ...    183  3e-45
pdb|1HBA_A|2.1 | 4| 141|N|HEMOGLOBIN ROTHSCHILD (DEOXY)         ...    183  3e-45
pdb|1HAC_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1HAC_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1HAB_C|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1HAB_A|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1GZX_C|2.1 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1GZX_A|2.1 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1GBV_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1GBV_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1GBU_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1GBU_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1G9V_C|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1G9V_A|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1FN3_C|2.48| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1FN3_A|2.48| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1FDH_A|2.5 | 2| 141|N|HEMOGLOBIN (DEOXY, HUMAN FETAL F=/II$=...    183  3e-45
pdb|1DXV_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1 R...    183  3e-45
pdb|1DXV_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1 R...    183  3e-45
pdb|1DXU_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1 R...    183  3e-45
pdb|1DXU_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1 R...    183  3e-45
pdb|1DXT_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH ADDITIO...    183  3e-45
pdb|1DXT_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH ADDITIO...    183  3e-45
pdb|1DKE_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN: ALPHA...    183  3e-45
pdb|1DKE_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN: ALPHA...    183  3e-45
pdb|1COH_C|2.9 | 4| 141|N|ALPHA-FERROUS-CARBONMONOXY, BETA-COBAL...    183  3e-45
pdb|1COH_A|2.9 | 4| 141|N|ALPHA-FERROUS-CARBONMONOXY, BETA-COBAL...    183  3e-45
pdb|1CMY_C|3.0 | 4| 141|N|HEMOGLOBIN YPSILANTI (CARBON MONOXY FO...    183  3e-45
pdb|1CMY_A|3.0 | 4| 141|N|HEMOGLOBIN YPSILANTI (CARBON MONOXY FO...    183  3e-45
pdb|1CLS_C|1.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1CLS_A|1.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1BZ0_C|1.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1BZ0_A|1.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  3e-45
pdb|1BUW_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1BUW_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1BIJ_C|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1BIJ_A|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHA...    183  3e-45
pdb|1BBB_C|1.7 | 4| 141|N|HEMOGLOBIN A (R2 STATE, CARBONMONOXY) ...    183  3e-45
pdb|1BBB_A|1.7 | 4| 141|N|HEMOGLOBIN A (R2 STATE, CARBONMONOXY) ...    183  3e-45
pdb|1B86_C|2.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1B86_A|2.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1A9W_C|2.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1A9W_A|2.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1A3N_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1A3N_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    183  3e-45
pdb|1A0Z_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A0Z_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A0U_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A0U_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A01_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A01_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A00_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1A00_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A...    183  3e-45
pdb|1BAB_C|1.5 | 4| 142|M|HEMOGLOBIN THIONVILLE ALPHA CHAIN MUTA...    183  3e-45
pdb|1BAB_A|1.5 | 4| 142|M|HEMOGLOBIN THIONVILLE ALPHA CHAIN MUTA...    183  3e-45
prf|671045A|hemoglobin alpha                                           183  4e-45
pdb|1HDA_C|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  4e-45
pdb|1HDA_A|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY)                    ...    183  4e-45
pdb|1G0A_C|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1G0A_A|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1G09_C|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1G09_A|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1G08_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1G08_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1FSX_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1FSX_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    183  4e-45
pdb|1IBE_A|1.8 | 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY...    183  4e-45
sp|P21768|HBA_MACSI Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    183  4e-45
prf|1203228A|hemoglobin alpha                                          183  4e-45
sp|P07425|HBA_LAMVI Hemoglobin subunit alpha (Hemoglobin alpha c...    183  4e-45
prf|1412195A|hemoglobin alpha                                          183  4e-45
sp|P14389|HBA_PTEAL Hemoglobin subunit alpha (Hemoglobin alpha c...    183  4e-45
tr|Q53F97|Q53F97_HUMAN Alpha 2 globin variant (Fragment).              183  4e-45
prf|1004268B|hemoglobin alphaII                                        183  4e-45
sp|P01968|HBA2_BOSMU Hemoglobin subunit alpha-2 (Hemoglobin alph...    183  4e-45
sp|Q862A7|HBA_PIPAB Hemoglobin subunit alpha (Hemoglobin alpha c...    182  4e-45
prf|610524A|hemoglobin alpha                                           182  5e-45
sp|P01923|HBA_GORGO Hemoglobin subunit alpha (Hemoglobin alpha c...    182  5e-45
prf|2711193A|Hb                                                        182  5e-45
prf|1412195B|hemoglobin alpha                                          182  5e-45
sp|P14390|HBA_PTEPO Hemoglobin subunit alpha (Hemoglobin alpha c...    182  5e-45
prf|1012236A|hemoglobin alphaE                                         182  5e-45
sp|P01926|HBA_CERAE Hemoglobin subunit alpha (Hemoglobin alpha c...    182  5e-45
sp|Q9TSN9|HBA3_BUBBU Hemoglobin subunit alpha-3 (Hemoglobin alph...    182  5e-45
sp|P10883|HBA_PANTS Hemoglobin subunit alpha (Hemoglobin alpha c...    182  6e-45
tr|A4ZQI9|A4ZQI9_PERMA Hemoglobin alpha subunit 1.                     182  6e-45
sp|P01929|HBA_SAGFU Hemoglobin subunit alpha (Hemoglobin alpha c...    182  6e-45
prf|0407252A|hemoglobin alpha                                          182  6e-45
sp|P01973|HBA_LAMGL Hemoglobin subunit alpha (Hemoglobin alpha c...    182  6e-45
sp|Q7M3B6|HBA_SAGMY Hemoglobin subunit alpha (Hemoglobin alpha c...    182  6e-45
prf|1509322A|hemoglobin alpha                                          182  6e-45
sp|P21767|HBA_MACFA Hemoglobin subunit alpha-A/Q/R/T (Hemoglobin...    182  6e-45
prf|1206221A|hemoglobin alphaI                                         182  7e-45
prf|1008176A|hemoglobin alpha                                          182  7e-45
prf|1706193A|hemoglobin alpha                                          182  7e-45
sp|P21379|HBA_RANTA Hemoglobin subunit alpha (Hemoglobin alpha c...    182  7e-45
pdb|1O1K_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
pdb|1O1K_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
pdb|1J7W_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    182  8e-45
pdb|1J7W_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    182  8e-45
pdb|1C7B_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN (...    182  8e-45
pdb|1C7B_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN (...    182  8e-45
pdb|1BZZ_C|1.59| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
pdb|1BZZ_A|1.59| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
pdb|1O1O_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
pdb|1O1O_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    182  8e-45
prf|0404170A|hemoglobin alphaI                                         182  8e-45
pdb|1AJ9_A|2.2 | 2| 141|M|MOL_ID: 1; MOLECULE: CARBOXYHEMOGLOBIN...    182  8e-45
prf|1105218A|hemoglobin alpha                                          182  8e-45
prf|0603229B|hemoglobin alpha                                          182  9e-45
prf|1211215B|hemoglobin alphaII                                        182  9e-45
sp|P20019|HBA2_LEMVA Hemoglobin subunit alpha-2 (Hemoglobin alph...    182  9e-45
prf|1211215A|hemoglobin alphaI                                         182  9e-45
sp|P20018|HBA1_LEMVA Hemoglobin subunit alpha-1 (Hemoglobin alph...    182  9e-45
prf|1805193A|hemoglobin                                                182  9e-45
sp|P24659|HBA_MACGG Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    182  9e-45
prf|701209A|hemoglobin alpha                                           181  1e-44
prf|681081A|hemoglobin alpha                                           181  1e-44
prf|671047A|hemoglobin Aalpha                                          181  1e-44
prf|731916A|hemoglobin alpha                                           181  1e-44
sp|P01924|HBA_SEMEN Hemoglobin subunit alpha (Hemoglobin alpha c...    181  1e-44
sp|P21766|HBA_MACAS Hemoglobin subunit alpha-1/2/3 (Hemoglobin a...    181  1e-44
prf|1804207A|hemoglobin                                                181  1e-44
sp|P24291|HBA_ECHTE Hemoglobin subunit alpha (Hemoglobin alpha c...    181  1e-44
prf|1702181A|hemoglobin alpha                                          181  1e-44
sp|P19645|HBA_PAGLA Hemoglobin subunit alpha (Hemoglobin alpha c...    181  1e-44
sp|P11753|HBA_CYNSP Hemoglobin subunit alpha (Hemoglobin alpha c...    181  1e-44
pdb|1O1N_A|1.80| 3| 285|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    181  1e-44
prf|1202213A|Hb alpha                                                  181  2e-44
sp|P07402|HBA_MACSP Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    181  2e-44
sp|Q7M3B8|HBA1_HAPGR Hemoglobin subunit alpha-1 (Hemoglobin alph...    181  2e-44
prf|770504A|hemoglobin alpha                                           181  2e-44
pdb|1A3O_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    181  2e-44
pdb|1A3O_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    181  2e-44
tr|A4ZQG8|A4ZQG8_PERMA Hemoglobin alpha subunit 1.                     181  2e-44
pdb|1Y0D_C|2.10| 4| 140|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    181  2e-44
pdb|1Y0D_A|2.10| 4| 140|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    181  2e-44
prf|0510161A|hemoglobin alphaI                                         180  2e-44
sp|P19002|HBA_MACNE Hemoglobin subunit alpha-1/2/3 (Hemoglobin a...    180  2e-44
pdb|1VWT_C|1.9 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    180  2e-44
pdb|1VWT_A|1.9 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    180  2e-44
pdb|1RVW_A|2.5 | 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    180  2e-44
prf|731485A|hemoglobin alpha                                           180  3e-44
pdb|1R1Y_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1R1Y_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1R1X_A|2.15| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
tr|A4ZQM2|A4ZQM2_PERMA Hemoglobin alpha subunit 1.                     180  3e-44
pdb|1YDZ_C|3.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1YDZ_A|3.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1Y0C_C|2.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1Y0C_A|2.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
tr|Q3LRX5|Q3LRX5_PONPY Alpha globin a3.                                180  3e-44
sp|P04237|HBA_TRAST Hemoglobin subunit alpha (Hemoglobin alpha c...    180  3e-44
sp|P18978|HBA_TURTR Hemoglobin subunit alpha (Hemoglobin alpha c...    180  3e-44
pdb|1XZ5_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1XZ5_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  3e-44
pdb|1XY0_C|1.99| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  4e-44
pdb|1XY0_A|1.99| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  4e-44
pdb|1O1J_A|1.90| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    180  4e-44
pdb|1O1M_A|1.85| 3| 285|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  4e-44
prf|0510161B|hemoglobin alphaII                                        179  4e-44
pdb|1XZU_C|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  5e-44
pdb|1XZU_A|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  5e-44
prf|2722305D|Hb                                                        179  5e-44
prf|764140A|hemoglobin alpha                                           179  6e-44
tr|A4ZQL5|A4ZQL5_PERMA Hemoglobin alpha subunit 1.                     179  6e-44
tr|A4ZQH7|A4ZQH7_PERMA Hemoglobin alpha subunit 1.                     179  6e-44
pdb|1GLI_C|2.5 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN; ...    179  6e-44
pdb|1GLI_A|2.5 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN; ...    179  6e-44
pdb|1XZV_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
pdb|1XZV_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
prf|1409215A|hemoglobin alpha                                          179  6e-44
pdb|1Y8W_C|2.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
pdb|1Y8W_A|2.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
pdb|1XZ7_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
pdb|1XZ7_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  6e-44
sp|P07414|HBA_TRIIN Hemoglobin subunit alpha (Hemoglobin alpha c...    179  6e-44
prf|1402398A|hemoglobin alpha                                          179  6e-44
pdb|1O1L_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  7e-44
pdb|1Y09_C|2.25| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  7e-44
pdb|1Y09_A|2.25| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    179  7e-44
sp|P01932|HBA_THEGE Hemoglobin subunit alpha (Hemoglobin alpha c...    179  8e-44
prf|2722305B|Hb                                                        178  9e-44
pdb|1Y0A_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
pdb|1Y0A_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
pdb|1XZ4_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
pdb|1XZ4_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
pdb|1XYE_C|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
pdb|1XYE_A|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  9e-44
tr|A4ZQG9|A4ZQG9_PERMA Hemoglobin alpha subunit 1.                     178  9e-44
prf|1309192A|hemoglobin alpha                                          178  1e-43
pdb|1O1I_A|2.30| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...    178  1e-43
prf|1505265A|hemoglobin alpha                                          178  1e-43
tr|A4ZQL9|A4ZQL9_PERMA Hemoglobin alpha subunit 1.                     178  1e-43
prf|2722305A|Hb                                                        178  1e-43
prf|1509220A|hemoglobin alpha                                          178  1e-43
sp|P14525|HBA_BRATR Hemoglobin subunit alpha (Hemoglobin alpha c...    178  1e-43
pdb|1QI8_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
pdb|1QI8_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
pdb|1J7Y_C|1.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
pdb|1J7Y_A|1.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
pdb|1J7S_C|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
pdb|1J7S_A|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    178  1e-43
tr|A9L8T9|A9L8T9_PAPAN Hemoglobin, alpha 1 (Predicted).                178  1e-43
sp|P63112|HBA_PAPCY Hemoglobin subunit alpha (Hemoglobin alpha c...    178  1e-43
sp|P63111|HBA_PAPAN Hemoglobin subunit alpha (Hemoglobin alpha c...    178  1e-43
tr|Q9CY10|Q9CY10_MOUSE 13 days embryo liver cDNA, RIKEN full-len...    178  1e-43
sp|P14259|HBA1_GALCR Hemoglobin subunit alpha-A (Hemoglobin alph...    177  2e-43
prf|1504343A|alpha globin                                              177  2e-43
tr|A4ZQJ4|A4ZQJ4_PERMA Hemoglobin alpha subunit 1.                     177  2e-43
tr|A4ZQL6|A4ZQL6_PERMA Hemoglobin alpha subunit 1.                     177  2e-43
tr|A4ZQK0|A4ZQK0_PERMA Hemoglobin alpha subunit 1.                     177  2e-43
prf|1008177A|hemoglobin alpha                                          177  3e-43
prf|0709565A|globin alpha2 mutant                                      177  3e-43
prf|0605225A|globin alpha                                              177  3e-43
sp|P01955|HBA_LOXAF Hemoglobin subunit alpha (Hemoglobin alpha c...    177  3e-43
tr|A4ZQK5|A4ZQK5_PERMA Hemoglobin alpha subunit 1.                     176  3e-43
tr|A4ZQJ0|A4ZQJ0_PERMA Hemoglobin alpha subunit 1.                     176  4e-43
tr|A4ZQK4|A4ZQK4_PERMA Hemoglobin alpha subunit 1.                     176  4e-43
prf|0808262A|hemoglobin alpha                                          176  4e-43
sp|P01954|HBA_ELEMA Hemoglobin subunit alpha (Hemoglobin alpha c...    176  4e-43
prf|1205199A|hemoglobin alphaII                                        176  5e-43
sp|P09904|HBA_PHYCA Hemoglobin subunit alpha (Hemoglobin alpha c...    176  5e-43
tr|A4ZQK2|A4ZQK2_PERMA Hemoglobin alpha subunit 1.                     176  5e-43
tr|A4ZQM3|A4ZQM3_PERMA Hemoglobin alpha subunit 1.                     176  5e-43
sp|P01933|HBA_CERTO Hemoglobin subunit alpha (Hemoglobin alpha c...    176  6e-43
prf|0605162A|hemoglobin alpha                                          176  6e-43
tr|A4ZQM7|A4ZQM7_PERMA Hemoglobin alpha subunit 1.                     176  6e-43
prf|1406207A|hemoglobin alphaI                                         176  7e-43
sp|P08258|HBA_MANSP Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    176  7e-43
prf|2722305C|Hb                                                        175  8e-43
tr|A4ZQG6|A4ZQG6_PERMA Hemoglobin alpha subunit 1.                     175  8e-43
tr|A4ZQK8|A4ZQK8_PERMA Hemoglobin alpha subunit 1.                     175  9e-43
tr|A4ZQL3|A4ZQL3_PERMA Hemoglobin alpha subunit 1.                     174  1e-42
tr|A4ZQK6|A4ZQK6_PERMA Hemoglobin alpha subunit 1.                     174  1e-42
sp|P01935|HBA3_PANTR Hemoglobin subunit alpha-3 (Hemoglobin alph...    174  1e-42
tr|A4ZQJ7|A4ZQJ7_PERMA Hemoglobin alpha subunit 1.                     174  2e-42
sp|Q9XSN2|HBA1_EQUGR Hemoglobin subunit alpha-1 (Hemoglobin alph...    174  2e-42
tr|A4ZQI1|A4ZQI1_PERMA Hemoglobin alpha subunit 1.                     174  2e-42
tr|A4ZQH0|A4ZQH0_PERMA Hemoglobin alpha subunit 1 (Alpha globin).      174  2e-42
prf|1715185A|hemoglobin                                                174  2e-42
sp|P23019|HBA_PROCR Hemoglobin subunit alpha (Hemoglobin alpha c...    174  2e-42
tr|A4ZQM0|A4ZQM0_PERMA Hemoglobin alpha subunit 1.                     174  2e-42
prf|732180B|hemoglobin alpha3                                          174  2e-42
sp|P01934|HBA3_GORGO Hemoglobin subunit alpha-3 (Hemoglobin alph...    174  2e-42
tr|A4ZQJ1|A4ZQJ1_PERMA Hemoglobin alpha subunit 1.                     174  2e-42
prf|1708178A|hemoglobin alpha1                                         173  4e-42
tr|A4ZQL4|A4ZQL4_PERMA Hemoglobin alpha subunit 1.                     173  4e-42
prf|0910195A|hemoglobin alpha                                          173  4e-42
sp|P01957|HBA_PROHA Hemoglobin subunit alpha (Hemoglobin alpha c...    173  4e-42
tr|A4ZQH2|A4ZQH2_PERMA Hemoglobin alpha subunit 1.                     172  5e-42
prf|1306390B|globin alpha1                                             172  5e-42
prf|3114362B|globin                                                    172  6e-42
tr|Q6H1L9|Q6H1L9_MACEU Theta globin.                                   172  6e-42
tr|A4ZQI0|A4ZQI0_PERMA Hemoglobin alpha subunit 1.                     172  9e-42
prf|1814300B|globin                                                    172  9e-42
tr|A4ZQJ8|A4ZQJ8_PERMA Hemoglobin alpha subunit 1.                     172  9e-42
sp|P15162|HBA_APUAP Hemoglobin subunit alpha-A (Hemoglobin alpha...    171  1e-41
prf|732180A|hemoglobin alpha3                                          171  2e-41
tr|B2BSP2|B2BSP2_PERMA Hemoglobin alpha chain.                         171  2e-41
prf|3114362A|globin                                                    171  2e-41
sp|P81043|HBA_MACEU Hemoglobin subunit alpha (Hemoglobin alpha c...    171  2e-41
tr|A4ZQL8|A4ZQL8_PERMA Hemoglobin alpha subunit 1.                     171  2e-41
pdb|1HDS_C|1.98| 4| 141|N|HEMOGLOBIN (SICKLE CELL)              ...    171  2e-41
pdb|1HDS_A|1.98| 4| 141|N|HEMOGLOBIN (SICKLE CELL)              ...    171  2e-41
tr|A4ZQH3|A4ZQH3_PERMA Hemoglobin alpha subunit 1.                     170  3e-41
sp|P01985|HBA_ANSSE Hemoglobin subunit alpha-A (Hemoglobin alpha...    170  3e-41
tr|A4ZQ59|A4ZQ59_PERMA Hemoglobin subunit theta (Theta globin).        170  3e-41
prf|0709222C|hemoglobin alpha                                          169  4e-41
sp|P01998|HBA_CRONI Hemoglobin subunit alpha (Hemoglobin alpha c...    169  4e-41
tr|A4ZQI5|A4ZQI5_PERMA Hemoglobin alpha subunit 1.                     169  5e-41
prf|1601314A|hemoglobin alphaA                                         169  5e-41
prf|1403265A|hemoglobin alpha                                          169  6e-41
sp|P11751|HBA_MEGLY Hemoglobin subunit alpha (Hemoglobin alpha c...    169  6e-41
tr|A4ZQ74|A4ZQ74_PERMA Hemoglobin subunit theta.                       169  6e-41
tr|A4ZQ86|A4ZQ86_PERLE Hemoglobin subunit theta.                       168  1e-40
tr|A4ZQ34|A4ZQ34_PERMA Hemoglobin subunit theta (Hemoglobin thet...    168  1e-40
tr|A4ZQ81|A4ZQ81_PERMA Hemoglobin subunit theta.                       168  1e-40
sp|P01989|HBA_ANSAN Hemoglobin subunit alpha-A (Hemoglobin alpha...    168  1e-40
tr|A4ZQG2|A4ZQG2_PERMA Hemoglobin alpha subunit 1.                     167  2e-40
tr|A4ZQ79|A4ZQ79_PERMA Hemoglobin subunit theta.                       167  2e-40
prf|0903200A|hemoglobin alpha                                          167  2e-40
sp|P22740|HBA_ANAPE Hemoglobin subunit alpha-A (Hemoglobin alpha...    167  2e-40
prf|711675A|hemoglobin alpha                                           167  2e-40
sp|P01975|HBA_MACGI Hemoglobin subunit alpha (Hemoglobin alpha c...    167  2e-40
tr|A4ZQ75|A4ZQ75_PERMA Hemoglobin subunit theta.                       167  2e-40
tr|A4ZQ77|A4ZQ77_PERMA Hemoglobin subunit theta.                       167  2e-40
sp|P01986|HBA_ANAPL Hemoglobin subunit alpha-A (Hemoglobin alpha...    167  2e-40
tr|A4ZQ82|A4ZQ82_PERMA Hemoglobin subunit theta.                       167  2e-40
sp|P18971|HBA_BALAC Hemoglobin subunit alpha (Hemoglobin alpha c...    167  2e-40
tr|A4ZQ65|A4ZQ65_PERMA Hemoglobin subunit theta.                       167  3e-40
tr|A4ZQ60|A4ZQ60_PERMA Hemoglobin subunit theta.                       167  3e-40
sp|P01988|HBA_ANAPP Hemoglobin subunit alpha-A (Hemoglobin alpha...    167  3e-40
tr|A4ZQ37|A4ZQ37_PERMA Hemoglobin subunit theta.                       166  3e-40
prf|2907304B|Hb                                                        166  4e-40
tr|A4ZQG4|A4ZQG4_PERMA Hemoglobin alpha subunit 1.                     166  4e-40
sp|P01996|HBA_ARAAR Hemoglobin subunit alpha-A (Hemoglobin alpha...    166  5e-40
prf|1509223A|hemoglobin alpha                                          166  5e-40
sp|P18973|HBA_CROCR Hemoglobin subunit alpha (Hemoglobin alpha c...    166  5e-40
tr|A4ZQ69|A4ZQ69_PERMA Hemoglobin subunit theta.                       166  5e-40
sp|P07419|HBA_DASVI Hemoglobin subunit alpha (Hemoglobin alpha c...    166  6e-40
prf|0507225A|hemoglobin alpha                                          166  7e-40
pdb|1FAW_C|3.09| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...    166  7e-40
pdb|1FAW_A|3.09| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...    166  7e-40
sp|P01987|HBA_CAIMO Hemoglobin subunit alpha-A (Hemoglobin alpha...    166  7e-40
sp|P01999|HBA_ALLMI Hemoglobin subunit alpha (Hemoglobin alpha c...    165  8e-40
prf|0809271A|hemoglobin Aalpha                                         165  1e-39
sp|P01991|HBA_BRACA Hemoglobin subunit alpha-A (Hemoglobin alpha...    165  1e-39
tr|A4ZQ55|A4ZQ55_PERMA Hemoglobin subunit theta.                       165  1e-39
sp|P01990|HBA_ANSIN Hemoglobin subunit alpha-A (Hemoglobin alpha...    165  1e-39
prf|0505220A|hemoglobin alpha                                          164  1e-39
sp|P01976|HBA_DIDMA Hemoglobin subunit alpha (Hemoglobin alpha c...    164  1e-39
prf|0907199A|hemoglobin A-alpha                                        164  2e-39
tr|Q5XME0|Q5XME0_OXYVI Alpha A hemoglobin.                             164  2e-39
tr|Q5XMD9|Q5XMD9_OXYJA Alpha A hemoglobin.                             164  2e-39
tr|Q5XMD8|Q5XMD8_9AVES Alpha A hemoglobin.                             164  2e-39
tr|Q5XMD7|Q5XMD7_OXYLE Alpha A hemoglobin.                             164  2e-39
tr|Q5XMD6|Q5XMD6_9AVES Alpha A hemoglobin.                             164  2e-39
prf|732172A|hemoglobin 1Balpha                                         164  2e-39
sp|P01977|HBA1_TACAC Hemoglobin subunit alpha-1 (Hemoglobin alph...    164  2e-39
tr|A4ZQ71|A4ZQ71_PERMA Hemoglobin subunit theta.                       164  2e-39
prf|1106157A|hemoglobin A-alpha                                        164  2e-39
tr|A4ZQI8|A4ZQI8_PERMA Hemoglobin alpha subunit 1.                     164  2e-39
tr|B2KHW1|B2KHW1_RHIFE Theta 1 globin (Predicted).                     164  3e-39
prf|681088A|hemoglobin Aalpha                                          164  3e-39
prf|1201305A|globin alpha                                              163  3e-39
prf|0709222B|hemoglobin alpha                                          163  3e-39
prf|0708168A|globin alpha                                              163  4e-39
prf|2907304A|Hb                                                        163  4e-39
tr|Q5XME1|Q5XME1_9AVES Alpha A hemoglobin.                             163  4e-39
prf|0902190A|globin alphaA                                             163  4e-39
tr|A4ZQ62|A4ZQ62_PERMA Hemoglobin subunit theta.                       163  4e-39
prf|0807239A|hemoglobin alpha                                          162  5e-39
prf|0608224A|hemoglobin alpha                                          162  5e-39
pdb|1HV4_G|2.80| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...    162  5e-39
pdb|1HV4_E|2.80| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...    162  5e-39
pdb|1HV4_C|2.80| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...    162  5e-39
pdb|1HV4_A|2.80| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...    162  5e-39
pdb|1A4F_A|2.0 | 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...    162  5e-39
prf|0809271B|hemoglobin Aalpha                                         162  7e-39
sp|P01992|HBA_CYGOL Hemoglobin subunit alpha-A (Hemoglobin alpha...    162  7e-39
sp|P24589|HBA_COTJA Hemoglobin subunit alpha-A (Hemoglobin alpha...    162  7e-39
sp|P01993|HBA_AQUCH Hemoglobin subunit alpha-A (Hemoglobin alpha...    162  7e-39
tr|Q7ZT87|Q7ZT87_9AVES Alpha A globin.                                 162  8e-39
sp|P84790|HBA_AYTFU Hemoglobin subunit alpha-A (Hemoglobin alpha...    162  1e-38
tr|Q9QWJ3|Q9QWJ3_MOUSE Alpha-1-globin (Fragment).                      161  1e-38
sp|P01984|HBA_PHORU Hemoglobin subunit alpha-A (Hemoglobin alpha...    161  1e-38
pdb|1C40_A|2.30| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...    161  2e-38
sp|P08850|HBA_ACCGE Hemoglobin subunit alpha-A (Hemoglobin alpha...    160  2e-38
prf|742500A|hemoglobin alpha                                           160  2e-38
sp|P01979|HBA_ORNAN Hemoglobin subunit alpha (Hemoglobin alpha c...    160  2e-38
prf|2704324C|Hb                                                        160  2e-38
prf|732173A|hemoglobin AalphaII                                        160  2e-38
sp|P01978|HBA2_TACAC Hemoglobin subunit alpha-2 (Hemoglobin alph...    160  2e-38
prf|701212A|hemoglobin alpha                                           160  2e-38
sp|P01980|HBA_APTFO Hemoglobin subunit alpha (Hemoglobin alpha c...    160  2e-38
prf|2704324D|Hb                                                        160  2e-38
sp|P01972|HBA_ODOVI Hemoglobin subunit alpha-1/2 (Hemoglobin alp...    160  2e-38
prf|1204291A|globin                                                    160  3e-38
prf|1708167A|hemoglobin alpha A                                        160  3e-38
prf|0905215A|globin alphaA                                             160  3e-38
prf|0611229A|globin alphaS                                             160  3e-38
sp|P01994|HBA_CHICK Hemoglobin subunit alpha-A (Hemoglobin alpha...    160  3e-38
prf|0804242A|hemoglobin Aalpha                                         160  4e-38
sp|P01995|HBA_PHACO Hemoglobin subunit alpha-A (Hemoglobin alpha...    160  4e-38
prf|0908229A|hemoglobin Aalpha                                         160  4e-38
sp|P81023|HBA_MELGA Hemoglobin subunit alpha-A (Hemoglobin alpha...    159  4e-38
prf|1005216A|hemoglobin Aalpha                                         159  4e-38
tr|Q3U0A6|Q3U0A6_MOUSE Activated spleen cDNA, RIKEN full-length ...    159  4e-38
prf|2807208A|Hb                                                        159  6e-38
prf|1409216A|hemoglobin alpha                                          159  6e-38
sp|P10057|HBA_EUDCR Hemoglobin subunit alpha (Hemoglobin alpha c...    159  6e-38
sp|P07034|HBA_CHLME Hemoglobin subunit alpha-A (Hemoglobin alpha...    159  7e-38
prf|1408161A|hemoglobin alphaA                                         159  8e-38
sp|P08260|HBA_LARRI Hemoglobin subunit alpha-A (Hemoglobin alpha...    159  8e-38
prf|721931A|hemoglobin alpha                                           159  9e-38
sp|P21871|HBA_COLLI Hemoglobin subunit alpha-A (Hemoglobin alpha...    158  9e-38
prf|1306241B|hemoglobin alpha A                                        158  1e-37
sp|P22741|HBA_FRAPO Hemoglobin subunit alpha-A (Hemoglobin alpha...    158  1e-37
prf|2314132B|globin                                                    158  1e-37
prf|1004263A|hemoglobin Aalpha                                         158  1e-37
sp|P01997|HBA_STUVU Hemoglobin subunit alpha-A (Hemoglobin alpha...    158  1e-37
prf|1606255A|hemoglobin alpha                                          158  1e-37
prf|1406208A|hemoglobin A/A'                                           158  1e-37
sp|P08256|HBA_GYPRU Hemoglobin subunit alpha-A/A' (Hemoglobin al...    158  1e-37
sp|P07417|HBA_AEGMO Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  2e-37
prf|0711250A|globin alphaA                                             157  2e-37
prf|1501221A|hemoglobin alphaA                                         157  2e-37
sp|P10780|HBA_PHACA Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  2e-37
sp|Q8HY34|HBA_MONDO Hemoglobin subunit alpha (Hemoglobin alpha c...    157  2e-37
prf|1813173A|globin                                                    157  2e-37
prf|2119185A|hemoglobin                                                157  2e-37
prf|2216270A|hemoglobin                                                157  2e-37
sp|Q10732|HBA_CARCR Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  2e-37
prf|1510294A|hemoglobin alpha                                          157  2e-37
sp|P19831|HBA_PSIKR Hemoglobin subunit alpha (Hemoglobin alpha c...    157  2e-37
prf|1306390A|globin theta1                                             157  2e-37
tr|A9L8U0|A9L8U0_PAPAN Hemoglobin, theta 1 (Predicted).                157  2e-37
prf|2019265A|hemoglobin                                                157  3e-37
sp|Q7LZC3|HBA_STROE Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  3e-37
prf|1713376A|hemoglobin                                                157  3e-37
sp|P19789|HBA_EUDSC Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  3e-37
sp|P01983|HBA_CICCI Hemoglobin subunit alpha-A (Hemoglobin alpha...    157  3e-37
prf|2621286A|Hb                                                        157  3e-37
sp|P82111|HBA1_CATMA Hemoglobin subunit alpha-1 (Hemoglobin alph...    157  3e-37
tr|B1MT39|B1MT39_CALMO Theta 1 globin (Predicted).                     156  3e-37
prf|0903202B|hemoglobin Aalpha                                         156  4e-37
prf|1704310A|alpha globin                                              156  5e-37
prf|1509221A|hemoglobin alphaA                                         155  6e-37
sp|P14522|HBA_TURME Hemoglobin subunit alpha-A (Hemoglobin alpha...    155  6e-37
prf|711682A|hemoglobin AIIalpha                                        155  8e-37
prf|1304183B|hemoglobin alphaA                                         155  9e-37
prf|1606256A|hemoglobin alphaA                                         155  9e-37
sp|P01981|HBA_STRCA Hemoglobin subunit alpha-A (Hemoglobin alpha...    155  9e-37
prf|1411166A|hemoglobin A alpha                                        155  1e-36
sp|P10059|HBA_SPHPU Hemoglobin subunit alpha-A (Hemoglobin alpha...    155  1e-36
prf|0709222A|hemoglobin alpha                                          154  1e-36
sp|P02000|HBA_CAICR Hemoglobin subunit alpha (Hemoglobin alpha c...    154  1e-36
prf|1010262A|hemoglobin Aalpha                                         154  1e-36
prf|2706289J|Hb                                                        154  1e-36
prf|1507154A|theta1 globin                                             154  1e-36
prf|1207290A|globin theta1                                             154  1e-36
sp|P06890|HBAT_PONPY Hemoglobin subunit theta-1 (Hemoglobin thet...    154  1e-36
sp|P09105|HBAT_HUMAN Hemoglobin subunit theta-1 (Hemoglobin thet...    154  1e-36
prf|0608224B|hemoglobin alpha                                          154  2e-36
prf|1512172B|hemoglobin alphaA                                         154  2e-36
sp|P19832|HBA_TRIOC Hemoglobin subunit alpha-A (Hemoglobin alpha...    154  2e-36
prf|650438A|hemoglobin alpha                                           154  2e-36
prf|1404255A|hemoglobin alphaA                                         153  3e-36
sp|P13273|HBA_CHRPI Hemoglobin subunit alpha-A (Hemoglobin alpha...    153  3e-36
prf|0901255A|hemoglobin alpha                                          153  3e-36
prf|1402311A|theta1 globin                                             152  8e-36
prf|754932A|hemoglobin alpha                                           152  9e-36
tr|B0VX79|B0VX79_CALJA Theta 1 globin (Predicted).                     152  1e-35
prf|1111200A|hemoglobin alphaA                                         151  1e-35
sp|P07407|HBA_PASMO Hemoglobin subunit alpha-A (Hemoglobin alpha...    151  1e-35
sp|P83135|HBAA_GEONI Hemoglobin subunit alpha-A (Hemoglobin alph...    150  2e-35
prf|1202212A|Hb alphaA                                                 150  2e-35
sp|P07404|HBA_VULGR Hemoglobin subunit alpha-A (Hemoglobin alpha...    150  2e-35
prf|0903202A|hemoglobin Aalpha                                         150  3e-35
sp|P01982|HBA_RHEAM Hemoglobin subunit alpha-A (Hemoglobin alpha...    150  3e-35
prf|2806349A|hemoglobin                                                150  3e-35
sp|P83131|HBA1_ALDEL Hemoglobin A subunit alpha-1 (Hemoglobin A ...    148  9e-35
tr|Q9PVL9|Q9PVL9_HYNRE Larval alpha-globin.                            148  1e-34
sp|P02007|HBPI_CHICK Hemoglobin subunit pi (Hemoglobin pi chain)...    148  1e-34
tr|Q7T1E9|Q7T1E9_9SAUR Hemoglobin alpha-globin (Fragment).             148  2e-34
prf|2722385A|Hb                                                        146  5e-34
sp|P83132|HBA2_ALDEL Hemoglobin A subunit alpha-2 (Hemoglobin A ...    146  6e-34
prf|0904325A|globin pi'                                                145  7e-34
prf|0611226A|globin alpha-like pi                                      145  8e-34
prf|1001162A|globin alpha                                              144  1e-33
prf|0804242C|hemoglobin Dalpha                                         144  3e-33
sp|P02002|HBAD_PHACO Hemoglobin subunit alpha-D (Hemoglobin alph...    144  3e-33
prf|2706289F|HBAZ protein                                              144  3e-33
tr|Q6IBF6|Q6IBF6_HUMAN HBZ protein (Hemoglobin, zeta).                 144  3e-33
sp|P02008|HBAZ_HUMAN Hemoglobin subunit zeta (Hemoglobin zeta ch...    144  3e-33
prf|2722385B|Hb                                                        144  3e-33
prf|2704324A|Hb                                                        143  3e-33
tr|Q90ZA5|Q90ZA5_AMBME Alpha-globin.                                   143  4e-33
tr|A1A4Q7|A1A4Q7_BOVIN Similar to Chain A, Deoxy Rhb1.2 (Recombi...    143  4e-33
prf|1102208A|globin pi'                                                142  6e-33
sp|P04243|HBPI_CAIMO Hemoglobin subunit pi (Hemoglobin pi chain)...    142  6e-33
tr|Q533G8|Q533G8_MACEU Zeta' globin.                                   142  6e-33
prf|2119185B|hemoglobin                                                142  7e-33
sp|P81024|HBAD_MELGA Hemoglobin subunit alpha-D (Hemoglobin alph...    142  7e-33
tr|Q198B5|Q198B5_COLLI Alpah-A globin (Fragment).                      142  7e-33
prf|1404348A|zeta globin                                               142  8e-33
sp|P13787|HBAZ_HORSE Hemoglobin subunit zeta (Hemoglobin zeta ch...    142  8e-33
tr|B0VX76|B0VX76_CALJA Zeta globin (Predicted).                        142  8e-33
prf|0709223A|hemoglobin                                                142  9e-33
pdb|1JEB_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...    142  9e-33
pdb|1JEB_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...    142  9e-33
tr|B1MT33|B1MT33_CALMO Zeta globin (Predicted).                        142  9e-33
sp|P02009|HBAZ_PIG Hemoglobin subunit zeta (Hemoglobin zeta chai...    142  9e-33
prf|0905215B|globin alphaD                                             142  1e-32
pdb|1HBR_C|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHA...    142  1e-32
pdb|1HBR_A|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHA...    142  1e-32
sp|P02001|HBAD_CHICK Hemoglobin subunit alpha-D (Hemoglobin alph...    142  1e-32
prf|1208245B|hemoglobin alphaD                                         142  1e-32
sp|P04239|HBAD_ANSIN Hemoglobin subunit alpha-D (Hemoglobin alph...    142  1e-32
tr|Q1W6G9|Q1W6G9_HUMAN Hemoglobin zeta subunit.                        141  1e-32
prf|2106264A|hemoglobin                                                141  2e-32
sp|Q9PRL9|HBA1_NAJNA Hemoglobin subunit alpha-1 (Hemoglobin alph...    141  2e-32
sp|P06347|HBAZ_PANTR Hemoglobin subunit zeta (Hemoglobin zeta ch...    140  3e-32
pdb|1OUU_C|2.5 | 4| 142|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN I; CHA...    140  3e-32
pdb|1OUU_A|2.5 | 4| 142|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN I; CHA...    140  3e-32
pdb|1OUT_A|2.3 | 2| 142|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN I; CHA...    140  3e-32
prf|1601314C|hemoglobin alphaD                                         140  3e-32
sp|P15164|HBAD_APUAP Hemoglobin subunit alpha-D (Hemoglobin alph...    140  3e-32
sp|P11896|HBA3_PLEWA Hemoglobin larval subunit alpha (Hemoglobin...    140  3e-32
tr|Q98974|Q98974_ONCMY Alpha-globin IV.                                140  4e-32
prf|1911215A|hemoglobin                                                139  5e-32
sp|P30892|HBAD_COTJA Hemoglobin subunit alpha-D (Hemoglobin alph...    139  5e-32
prf|0909303C|hemoglobin zeta                                           139  5e-32
sp|P02003|HBAD_CAIMO Hemoglobin subunit alpha-D (Hemoglobin alph...    139  5e-32
prf|2704324B|Hb                                                        139  6e-32
sp|P04442|HBAD_ANAPL Hemoglobin subunit alpha-D (Hemoglobin alph...    139  7e-32
prf|1208245C|hemoglobin alphaD                                         139  9e-32
sp|P04240|HBAD_BRACA Hemoglobin subunit alpha-D (Hemoglobin alph...    139  9e-32
prf|751456A|hemoglobin AIalpha                                         138  1e-31
prf|1302222A|globin                                                    138  1e-31
sp|P13786|HBAZ_CAPHI Hemoglobin subunit zeta (Hemoglobin zeta ch...    138  1e-31
prf|1406208C|hemoglobin D/D'                                           138  1e-31
sp|P08257|HBAD_GYPRU Hemoglobin subunit alpha-D/D' (Hemoglobin a...    138  1e-31
prf|1306241A|hemoglobin alpha D                                        138  1e-31
sp|P08849|HBAD_ACCGE Hemoglobin subunit alpha-D (Hemoglobin alph...    138  1e-31

Go to top
>prf|1310208A|globin I alpha,major
          Length = 142

 Score =  233 bits (593), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 117/142 (82%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
Sbjct: 1   MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKFLASVSTVLTSKYR
Sbjct: 121 AMHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|B1H216|B1H216_RAT Hemoglobin alpha, adult chain 1.
          Length = 142

 Score =  233 bits (593), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 117/142 (82%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
Sbjct: 1   MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKFLASVSTVLTSKYR
Sbjct: 121 AMHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P01946|HBA_RAT Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  233 bits (593), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 117/142 (82%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
Sbjct: 1   MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKFLASVSTVLTSKYR
Sbjct: 121 AMHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|2006316A|hemoglobin
          Length = 141

 Score =  231 bits (588), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 116/141 (82%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSADDKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 
Sbjct: 1   VLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA
Sbjct: 61  KVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           MHASLDKFLASVSTVLTSKYR
Sbjct: 121 MHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2513356B|globin
          Length = 142

 Score =  230 bits (586), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 116/142 (81%), Positives = 116/142 (81%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
Sbjct: 1   MVLSAADKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKFLASVSTVLTSKYR
Sbjct: 121 AMHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|2513356A|globin
          Length = 142

 Score =  230 bits (586), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 116/142 (81%), Positives = 116/142 (81%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
Sbjct: 1   MVLSAADKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKFLASVSTVLTSKYR
Sbjct: 121 AMHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|752057A|hemoglobin alpha
          Length = 141

 Score =  216 bits (549), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 112/141 (79%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSADDKTNIKNCW             ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 
Sbjct: 1   VLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++B P ALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA
Sbjct: 61  KVADALAKAGAHLBBZPVALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           MHASLDKFL ++S VLTSKYR
Sbjct: 121 MHASLDKFLGNMSAVLTSKYR 141


Go to top
>tr|A4ZQC9|A4ZQC9_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  201 bits (511), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK N+K  W             AL+RMF++FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANVKAAWGKIGGHGAEYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ90|A4ZQ90_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  200 bits (509), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQA9|A4ZQA9_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  200 bits (508), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL+RMF++FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSAEDKANVKAAWGKIGGHGAEYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQC3|A4ZQC3_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  199 bits (506), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWSKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ87|A4ZQ87_PERMA Hemoglobin alpha subunit 2 (Hemoglobin alpha
           chain).
          Length = 142

 Score =  199 bits (506), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q9CWS5|Q9CWS5_MOUSE ES cells cDNA, RIKEN full-length enriched
           library, clone:2410006A12 product:HEMOGLOBIN, BETA ADULT
           MAJOR CHAIN, full insert sequence.
          Length = 142

 Score =  199 bits (505), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGDGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQD3|A4ZQD3_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  198 bits (504), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A8DUV3|A8DUV3_MOUSE Alpha-globin.
          Length = 142

 Score =  198 bits (504), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P01942|HBA_MOUSE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  198 bits (504), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A8DUV1|A8DUV1_MOUSE Alpha-globin.
          Length = 142

 Score =  198 bits (504), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYVAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKIADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ93|A4ZQ93_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  198 bits (504), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK N+K  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANVKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q61287|Q61287_MOUSE Alpha-globin.
          Length = 142

 Score =  198 bits (504), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYVAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q91VB8|Q91VB8_MOUSE 13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2500002C06 product:hemoglobin,
           beta adult major chain, full insert sequence (Hemoglobin
           alpha, adult chain 1) (Hemoglobin alpha, adult chain 2)
           (Alpha-globin) (Activated spleen cDNA, RIKEN full-
           length enriched library, clone:F830017P06
           product:hemoglobin alpha, adult chain 1, full insert
           sequence) (Alpha globin 2) (Alpha globin 1) (13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510047K14 product:hemoglobin, beta adult major
           chain, full insert sequence) (10, 11 days embryo whole
           body cDNA, RIKEN full- length enriched library,
           clone:2810017J06 product:hemoglobin, beta adult major
           chain, full insert sequence) (11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2700038O11 product:hemoglobin, beta adult major
           chain, full insert sequence) (11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2700038D19 product:hemoglobin, beta adult major
           chain, full insert sequence) (13 days embryo liver cDNA,
           RIKEN full-length enriched library, clone:2510049K03
           product:hemoglobin, beta adult major chain, full insert
           sequence) (13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510040M14 product:hemoglobin,
           beta adult major chain, full insert sequence) (13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510039E24 product:hemoglobin, beta adult major
           chain, full insert sequence) (13 days embryo liver cDNA,
           RIKEN full-length enriched library, clone:2510030E10
           product:hemoglobin, beta adult major chain, full insert
           sequence) (13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510029N07 product:hemoglobin,
           beta adult major chain, full insert sequence) (13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510029K11 product:hemoglobin, beta adult major
           chain, full insert sequence) (13 days embryo liver cDNA,
           RIKEN full-length enriched library, clone:2510029I10
           product:hemoglobin, beta adult major chain, full insert
           sequence) (13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510028L03 product:hemoglobin,
           beta adult major chain, full insert sequence) (13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510019L20 product:hemoglobin, beta adult major
           chain, full insert sequence) (13 days embryo liver cDNA,
           RIKEN full-length enriched library, clone:2510008N05
           product:hemoglobin, beta adult major chain, full insert
           sequence) (13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510008I03 product:hemoglobin,
           beta adult major chain, full insert sequence) (13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510008C04 product:hemoglobin, beta adult major
           chain, full insert sequence) (13 days embryo liver cDNA,
           RIKEN full-length enriched library, clone:2510006N19
           product:hemoglobin, beta adult major chain, full insert
           sequence) (Adult female placenta cDNA, RIKEN full-length
           enriched library, clone:1600012O02 product:hemoglobin,
           beta adult major chain, full insert sequence) (Adult
           male spleen cDNA, RIKEN full-length enriched library,
           clone:0910001I20 product:hemoglobin alpha, adult chain
           1, full insert sequence).
          Length = 142

 Score =  198 bits (504), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q8BPF4|Q8BPF4_MOUSE 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2700073B15
           product:hemoglobin, beta adult major chain, full insert
           sequence.
          Length = 142

 Score =  197 bits (502), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLARHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQB9|A4ZQB9_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  197 bits (502), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DV PGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVGPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q9CY06|Q9CY06_MOUSE 13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510040P05 product:hemoglobin,
           beta adult major chain, full insert sequence.
          Length = 142

 Score =  197 bits (502), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF+ASVSTVLTSKYR
Sbjct: 121 AVHASLDKFIASVSTVLTSKYR 142


Go to top
>tr|A4ZQD0|A4ZQD0_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  197 bits (501), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALGRMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQG1|A4ZQG1_PERLE Hemoglobin alpha subunit 2.
          Length = 142

 Score =  197 bits (500), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL+RMF++FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSAEDKANVKAAWSKIGGHGAEYGAEALERMFSSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVADALATAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQD6|A4ZQD6_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  197 bits (500), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  GKVADALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQD4|A4ZQD4_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (499), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL+RMF++FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSAEDKANVKTAWSKIGGHGAEYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ88|A4ZQ88_PERMA Hemoglobin alpha subunit 2 (Hemoglobin alpha
           chain).
          Length = 142

 Score =  196 bits (498), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ96|A4ZQ96_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (498), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|0605191A|globin alpha
          Length = 141

 Score =  196 bits (498), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG 
Sbjct: 1   VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|671051A|hemoglobin alpha
          Length = 141

 Score =  196 bits (498), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK+NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK HG 
Sbjct: 1   VLSGEDKSNIKAAWGKIGGHAGEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALATAGAHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQC5|A4ZQC5_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (498), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL+RMF++FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSAEDKANVKTAWSKIGGHGADYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQB2|A4ZQB2_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (498), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKL VDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLHVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQF6|A4ZQF6_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (497), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +F TTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFSTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1613344A|hemoglobin alpha
          Length = 141

 Score =  196 bits (497), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 107/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWEKIGSHASEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHA+KLRVDPVNFKFLSHCLLVTLA HHP +FTPA
Sbjct: 61  KVAEALTNAVAHLDDLPGALSTLSDLHAYKLRVDPVNFKFLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF +SVSTVLTSKYR
Sbjct: 121 VHASLDKFFSSVSTVLTSKYR 141


Go to top
>sp|P26915|HBA_NASNA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  196 bits (497), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 107/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWEKIGSHASEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHA+KLRVDPVNFKFLSHCLLVTLA HHP +FTPA
Sbjct: 61  KVAEALTNAVAHLDDLPGALSTLSDLHAYKLRVDPVNFKFLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF +SVSTVLTSKYR
Sbjct: 121 VHASLDKFFSSVSTVLTSKYR 141


Go to top
>tr|A4ZQE9|A4ZQE9_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (497), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSD HAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVAGALATAASHLDDLPGALSALSDPHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQD9|A4ZQD9_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  196 bits (497), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVADALATAAGHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|0712204A|hemoglobin alpha
          Length = 141

 Score =  194 bits (494), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA+DK N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSANDKANVKAAWDKVGGQAANYGAEALERTFASFPTTKTYFPHYDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                       ++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTKAVGSMDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01950|HBA_SUNMU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  194 bits (494), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA+DK N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSANDKANVKAAWDKVGGQAANYGAEALERTFASFPTTKTYFPHYDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                       ++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTKAVGSMDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P18969|HBA_AILFU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  194 bits (494), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 107/142 (75%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKTNVKSTWDKLGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FTP
Sbjct: 61  KKVADALTLAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>tr|A4ZQB7|A4ZQB7_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  194 bits (494), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVAGALATAASHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQ92|A4ZQ92_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  193 bits (490), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF + PTTKTYF H DVSPGSAQVK HG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSSPTTKTYFPHFDVSPGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVAGALATAASHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1309193A|hemoglobin alpha1
          Length = 141

 Score =  193 bits (490), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 106/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPEDKNNVKAAWSKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHA+KLRVDPVNFK LSHCLLVTLACH+PG+FTPA
Sbjct: 61  KVGEALTTAVNHMDDLPGALSTLSDLHAYKLRVDPVNFKLLSHCLLVTLACHNPGEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P11755|HBA1_TADBR Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 141

 Score =  193 bits (490), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 106/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPEDKNNVKAAWSKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHA+KLRVDPVNFK LSHCLLVTLACH+PG+FTPA
Sbjct: 61  KVGEALTTAVNHMDDLPGALSTLSDLHAYKLRVDPVNFKLLSHCLLVTLACHNPGEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P14387|HBA_ANTPA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  193 bits (490), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWDKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHPGDFTP
Sbjct: 61  KKVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVL SKYR
Sbjct: 121 AVHASLDKFLASVSTVLVSKYR 142


Go to top
>prf|0409309A|hemoglobin alpha
          Length = 141

 Score =  192 bits (489), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKGAWEKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVSHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01938|HBA_LORTA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  192 bits (489), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKTAWEKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVSHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQ95|A4ZQ95_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  192 bits (489), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 99/142 (69%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  GKVADALATAAGHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P68236|HBA_URSTH Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  192 bits (489), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFKFLSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTTAAGHLDDLPGALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>sp|P68237|HBA_URSML Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  192 bits (489), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFKFLSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTTAAGHLDDLPGALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>sp|P68235|HBA_URSMA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  192 bits (489), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 106/142 (74%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFKFLSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTTAAGHLDDLPGALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>tr|A4ZQK9|A4ZQK9_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  192 bits (488), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF++FPTTKTYF H DVSPGSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWSKIGGHHAEYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|731915A|hemoglobin alpha
          Length = 141

 Score =  192 bits (487), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKAAWEKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTNAVSHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01937|HBA_NYCCO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  192 bits (487), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKAAWEKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTNAVSHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|Q63910|Q63910_RAT Alpha globin.
          Length = 142

 Score =  191 bits (485), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS +DK NIK  W              + R+F  FP++KTYF H + S GS QVKAHG
Sbjct: 1   MVLSEEDKNNIKKAWVKIGNHAAEIGAETIGRLFIVFPSSKTYFPHFNTSEGSDQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLA HHPGDFTP
Sbjct: 61  KKVADALTNAASHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPGDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           AMHASLDKF ASVSTVLTSKYR
Sbjct: 121 AMHASLDKFFASVSTVLTSKYR 142


Go to top
>sp|P18970|HBA_AILME Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  191 bits (485), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>prf|1703248A|hemoglobin alpha
          Length = 141

 Score =  191 bits (485), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWDKIGGHGGEYGAEALERMFLSFPTTKTYFPHFDVSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALANAASHLDDLPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+V+TVLTSKYR
Sbjct: 121 VHASLDKFLATVATVLTSKYR 141


Go to top
>sp|P20854|HBA_CTEGU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  191 bits (485), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWDKIGGHGGEYGAEALERMFLSFPTTKTYFPHFDVSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALANAASHLDDLPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+V+TVLTSKYR
Sbjct: 121 VHASLDKFLATVATVLTSKYR 141


Go to top
>tr|Q28743|Q28743_SHEEP Alpha globin chain.
          Length = 142

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACHHP DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHHPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|0712202A|hemoglobin alpha
          Length = 141

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+NIK  W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSGTDKSNIKAAWDKVGAHAGEYGAEALERTFTSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGA+S LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTNAVGHLDDLPGAMSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLATVSTVLTSKYR 141


Go to top
>sp|P01951|HBA_TALEU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+NIK  W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSGTDKSNIKAAWDKVGAHAGEYGAEALERTFTSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGA+S LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTNAVGHLDDLPGAMSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLATVSTVLTSKYR 141


Go to top
>prf|1512173A|hemoglobin alpha
          Length = 141

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F AFPTTKTYF H D+SPGSAQVK HG 
Sbjct: 1   VLSPADKTNVKTTWDKIGGHAGEYGGEALERTFMAFPTTKTYFPHFDLSPGSAQVKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVSHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P15163|HBA_LEPWE Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin) (Hemoglobin
           alpha-I/II chain).
          Length = 141

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F AFPTTKTYF H D+SPGSAQVK HG 
Sbjct: 1   VLSPADKTNVKTTWDKIGGHAGEYGGEALERTFMAFPTTKTYFPHFDLSPGSAQVKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVSHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1312256A|hemoglobin alpha
          Length = 141

 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHPGDFTPA
Sbjct: 61  KVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVL SKYR
Sbjct: 121 VHASLDKFLASVSTVLVSKYR 141


Go to top
>tr|A4ZQF0|A4ZQF0_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RM  +FPTTKTYF H DVS GSAQVKAHG
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMLCSFPTTKTYFPHFDVSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  GKVADALATAAGHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1311238A|hemoglobin alpha
          Length = 141

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFKFLSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTTAAAHLDDLPGALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1203225A|hemoglobin alpha
          Length = 141

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFKFLSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTTAAGHLDDLPGALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01928|HBA_CEBAP Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  190 bits (483), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKTAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALSNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQG5|A4ZQG5_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 105/142 (73%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF++FPTTKTYF H DVSPGSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWSKIGGHHAEYGAEALERMFSSFPTTKTYFPHFDVSPGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0804243A|hemoglobin alpha
          Length = 141

 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 107/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKT++K  W             AL+RMFA+FP TKTYFSH+D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTHVKAFWGKVGGHAAEFGAEALERMFASFPPTKTYFSHMDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACH P DFTPA
Sbjct: 61  KVADALTLAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHLPDDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+DKF+A VSTVL SKYR
Sbjct: 121 VHASMDKFMAGVSTVLVSKYR 141


Go to top
>sp|P01964|HBA_DASNO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 107/141 (75%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKT++K  W             AL+RMFA+FP TKTYFSH+D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTHVKAFWGKVGGHAAEFGAEALERMFASFPPTKTYFSHMDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACH P DFTPA
Sbjct: 61  KVADALTLAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHLPDDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+DKF+A VSTVL SKYR
Sbjct: 121 VHASMDKFMAGVSTVLVSKYR 141


Go to top
>tr|A4ZQE7|A4ZQE7_PERMA Hemoglobin alpha subunit 2.
          Length = 142

 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF +FPTTKTYF H DVS GSAQVKAHG
Sbjct: 1   MVLSAEDKANVKTVWSKIGSHGAEYGAEALGRMFCSFPTTKTYFPHFDVSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  GKVADALATAAGHLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1505269A|hemoglobin alpha
          Length = 141

 Score =  190 bits (482), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKTTWDKLGGHAGEYGGEALERTFMSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>sp|P10778|HBA_ODORO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  190 bits (482), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKTTWDKLGGHAGEYGGEALERTFMSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>prf|1212251A|hemoglobin alpha
          Length = 141

 Score =  189 bits (481), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+CW             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKKNVKDCWEKIGGHGAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P09420|HBA_SPECI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (481), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+CW             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKKNVKDCWEKIGGHGAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P60530|HBA_CANLA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  189 bits (481), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTP
Sbjct: 61  KKVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF  +VSTVLTSKYR
Sbjct: 121 AVHASLDKFFTAVSTVLTSKYR 142


Go to top
>prf|1817361A|hemoglobin
          Length = 141

 Score =  189 bits (481), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K CW             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGDYGTEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTQAVAHIDDLPNALSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P41327|HBA_LYNLY Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (481), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K CW             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGDYGTEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTQAVAHIDDLPNALSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01930|HBA_COLBA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  189 bits (481), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKTAWGKVGGHGGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTLAAAHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|0412236A|hemoglobin alpha
          Length = 141

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK NIK  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  SVSTVLTSKYR
Sbjct: 121 VHASLDKFFTSVSTVLTSKYR 141


Go to top
>sp|P18977|HBA_PROLO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK NIK  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  SVSTVLTSKYR
Sbjct: 121 VHASLDKFFTSVSTVLTSKYR 141


Go to top
>sp|P01963|HBA_CERSI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 105/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSPTDKTNVKTAWGHVGAQAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHHPQDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSNVSTVLTSKYR 142


Go to top
>sp|Q9XSN3|HBA1_EQUBU Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 142

 Score =  189 bits (480), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK+N+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSADDKSNVKAAWGKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>sp|P19015|HBA_HIPAM Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (480), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA+DK+N+K  W             AL+RMF +FPTTKTYF H D+S GS+QVKAHG 
Sbjct: 1   VLSANDKSNVKAAWGKVGNHAPEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTKAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
            HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01945|HBA_MESAU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (480), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTNI   W             AL+RMF  +PTTKTYF H DVS GSAQVK HG 
Sbjct: 1   VLSAKDKTNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ASVSTVLTSKYR
Sbjct: 121 VHASLDKFFASVSTVLTSKYR 141


Go to top
>sp|P41329|HBA1_ARCGA Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1-globin) (Hemoglobin alpha-I chain).
          Length = 142

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTNIK  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSPADKTNIKTTWDKLGGHAGEYGGEALERTFMSFPTTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTP
Sbjct: 61  KKVADALTTAVAHMDDLPKALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSTVSTVLTSKYR 142


Go to top
>prf|1301216A|hemoglobin alpha
          Length = 141

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F AFPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKATWDKIGGHAGEYGGEALERTFTAFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVAHMDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P09908|HBA_PHOVI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R F AFPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKATWDKIGGHAGEYGGEALERTFTAFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVAHMDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1202311A|globin alpha1
          Length = 142

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTNIK  W             A++RMF  FPTTKTYF H D + GS Q+KAHG
Sbjct: 1   MVLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALSTLSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVSEALTKAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|P01948|HBA_RABIT Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTNIK  W             A++RMF  FPTTKTYF H D + GS Q+KAHG
Sbjct: 1   MVLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALSTLSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVSEALTKAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|Q9TS35|HBA1_HYLLA Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 142

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|B2KHV8|B2KHV8_RHIFE Theta 1 globin (Predicted) (Hemoglobin
           subunit alpha).
          Length = 142

 Score =  189 bits (479), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQ+K HG
Sbjct: 1   MVLSPSDKSNVKAAWDKVGGNAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQIKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                        ++DL GALS LSDLHAHKLRVDPVNFK LSHCLLVTLACH+PG+FTP
Sbjct: 61  KKVGDALTKAVGSIDDLAGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHNPGEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AIHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|B1MT35|B1MT35_CALMO Theta 1 globin (Predicted) (Alpha 2 globin
           variant) (Hemoglobin subunit alpha).
          Length = 142

 Score =  189 bits (479), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P67817|HBA_ATEGE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  189 bits (479), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P41330|HBA2_ARCGA Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2-globin) (Hemoglobin alpha-II chain).
          Length = 142

 Score =  188 bits (478), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+R F AFPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSPADKTNVKTTWDKLGGHAGEYGGEALERTFTAFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTP
Sbjct: 61  KKVADALTTAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>prf|0807251B|globin alphaII
          Length = 141

 Score =  188 bits (478), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKSNVKAAWGKVGSNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACHHP DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHHPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P60529|HBA_CANFA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  188 bits (478), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>prf|0912206A|hemoglobin alpha
          Length = 141

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK NIK  W             AL+RMF  +PTTKTYF H DVS GS QVKAHG 
Sbjct: 1   VLSGEDKNNIKTAWGKIGGHAAEYGAEALERMFVVYPTTKTYFPHFDVSHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHIPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01944|HBA_ONDZI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK NIK  W             AL+RMF  +PTTKTYF H DVS GS QVKAHG 
Sbjct: 1   VLSGEDKNNIKTAWGKIGGHAAEYGAEALERMFVVYPTTKTYFPHFDVSHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHIPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQJ3|A4ZQJ3_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF +FPTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKAVWSKNGGHRAEYGAEALGRMFCSFPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       ++++LPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVADALATAADNLDELPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1516157A|hemoglobin alpha
          Length = 141

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHVDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P20243|HBA_MUSPF Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHVDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1505266A|hemoglobin alpha
          Length = 141

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPAALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>sp|P10885|HBA_PTEBR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPAALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>prf|1109157A|hemoglobin alpha
          Length = 141

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K CW             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP A+S LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01958|HBA_HORSE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AVHASLDKFLSSVSTVLTSKYR 142


Go to top
>sp|P07405|HBA_FELCA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K CW             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP A+S LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTQAVAHMDDLPTAMSALSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>tr|Q28383|Q28383_HORSE Horse BII alpha-2 globin.
          Length = 142

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  QKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AVHASLDKFLSSVSTVLTSKYR 142


Go to top
>sp|P63109|HBA_PANON Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+AHG
Sbjct: 1   MVLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTP
Sbjct: 61  QKVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>prf|1012308A|globin alpha 1BII
          Length = 142

 Score =  187 bits (476), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AVHASLDKFLSSVSTVLTSKYR 142


Go to top
>sp|Q9XSE9|HBA_EQUPR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  187 bits (476), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AVHASLDKFLSSVSTVLTSKYR 142


Go to top
>sp|P18975|HBA_PANLE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  187 bits (476), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 104/142 (73%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+AHG
Sbjct: 1   MVLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTP
Sbjct: 61  QKVADALTKAVVHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSAVSTVLTSKYR 142


Go to top
>prf|732177A|hemoglobin alpha
          Length = 141

 Score =  187 bits (476), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKTAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALSNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1613153A|hemoglobin alpha
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFVSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DL GALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLDDLAGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>sp|P17689|HBA_MARFO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFVSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DL GALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLDDLAGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>prf|1303302A|globin
          Length = 142

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSPTDKSNVKAAWEKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP + TP
Sbjct: 61  KKVADALTNAVSHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAELTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HAS DKF+ASVSTVLTSKYR
Sbjct: 121 AVHASFDKFMASVSTVLTSKYR 142


Go to top
>prf|1401172A|hemoglobin alpha
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKTNVKASWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P11750|HBA_SPEPA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKTNVKASWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1203227A|hemoglobin alpha
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKTAWGKVGAHAGDYGADALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALSNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P07421|HBA_CEBCA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKTAWGKVGAHAGDYGADALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALSNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1708165A|hemoglobin alpha
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPNEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>sp|P21200|HBA_VULVU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPNEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>tr|B0VX78|B0VX78_CALJA Theta 1 globin (Predicted).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P01960|HBA_EQUZE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>sp|P01959|HBA_EQUAS Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>sp|Q7JFN6|HBA2_EQUGR Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2- globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>sp|Q9TVA3|HBA2_EQUBU Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2- globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWGKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>tr|A4ZQM1|A4ZQM1_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF +FPTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWSKIGVHHAEYGAEALGRMFCSFPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|765952A|hemoglobin alpha
          Length = 141

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS+QVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVGHIDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF+ASVSTVLTSKYR
Sbjct: 121 VHASLDKFVASVSTVLTSKYR 141


Go to top
>sp|P68240|HBA_SHEEP Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|P68238|HBA_CAPHI Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|P68239|HBA_AMMLE Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1612429A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P23601|HBA_MUSPU Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  187 bits (474), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>tr|Q28745|Q28745_SHEEP Alpha globin chain.
          Length = 142

 Score =  187 bits (474), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|Q0ZA50|HBA_PANHO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASV TVLTSKYR
Sbjct: 121 AVHASLDKFLASVGTVLTSKYR 142


Go to top
>prf|0309296A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+NIK  W             AL+RMF +FPTTKTYF H D+S GSAQ++AHG 
Sbjct: 1   VLSPGDKSNIKAAWGKIGGQAPQYGAEALERMFLSFPTTKTYFPHFDMSHGSAQIQAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDP NFK LSHC+LVTLACHHPGDFTP 
Sbjct: 61  KVADALSTAVGHLDDLPTALSALSDLHAHKLRVDPANFKLLSHCILVTLACHHPGDFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 IHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01941|HBA_TUPGL Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+NIK  W             AL+RMF +FPTTKTYF H D+S GSAQ++AHG 
Sbjct: 1   VLSPGDKSNIKAAWGKIGGQAPQYGAEALERMFLSFPTTKTYFPHFDMSHGSAQIQAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDP NFK LSHC+LVTLACHHPGDFTP 
Sbjct: 61  KVADALSTAVGHLDDLPTALSALSDLHAHKLRVDPANFKLLSHCILVTLACHHPGDFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 IHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|0810212A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPTDKTNVKTAWGHVGAQAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHHPQDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>prf|742499A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>prf|0402268A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>pdb|2B7H_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>pdb|2B7H_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>pdb|1FHJ_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA
           CHAIN); CHAIN: A
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>pdb|1FHJ_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA
           CHAIN); CHAIN: A
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>sp|P60523|HBA_CHRBR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK+ W             AL R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF  +VSTVLTSKYR
Sbjct: 121 VHASLDKFFTAVSTVLTSKYR 141


Go to top
>prf|1301215A|hemoglobin alpha
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNIKAAWDKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACH PG+FTPA
Sbjct: 61  KVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHLPGEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVL SKYR
Sbjct: 121 IHASLDKFLASVSTVLVSKYR 141


Go to top
>sp|P11757|HBA_MYOVE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNIKAAWDKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACH PG+FTPA
Sbjct: 61  KVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHLPGEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVL SKYR
Sbjct: 121 IHASLDKFLASVSTVLVSKYR 141


Go to top
>prf|2201323A|hemoglobin
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWDKVGGSAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVT+ACHHP DFTPA
Sbjct: 61  KVGDALGNAVAHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTVACHHPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVL SKYR
Sbjct: 121 VHASLDKFLANVSTVLVSKYR 141


Go to top
>sp|Q7M2Y4|HBA_CHAMP Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWDKVGGSAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVT+ACHHP DFTPA
Sbjct: 61  KVGDALGNAVAHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTVACHHPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVL SKYR
Sbjct: 121 VHASLDKFLANVSTVLVSKYR 141


Go to top
>sp|P01961|HBA_EQUHE Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 142

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGNAGDFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>prf|1718299A|hemoglobin
          Length = 141

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPADKTNIKTTWDKLGGHAGEYGGEALERTFMSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTTAVAHMDDLPKALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>sp|Q9XSK1|HBA4_BUBBU Hemoglobin subunit alpha-4 (Hemoglobin alpha-4
           chain) (Alpha-4-globin) (IIalpha4).
          Length = 142

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVANALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q28744|Q28744_SHEEP Alpha globin chain.
          Length = 142

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVKAAWDKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTP
Sbjct: 61  EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1108181A|hemoglobin alpha
          Length = 141

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK ++++ W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG 
Sbjct: 1   VLSPEDKNHVRSTWDKIGGHGAEYGAEALERMFTSFPTTKTYFPHFDVSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP 
Sbjct: 61  KVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPAEFTPG 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1006229A|hemoglobin alpha
          Length = 141

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK ++++ W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG 
Sbjct: 1   VLSPEDKNHVRSTWDKIGGHGAEYGAEALERMFTSFPTTKTYFPHFDVSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP 
Sbjct: 61  KVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPAEFTPG 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01943|HBA_SPAEH Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DK ++++ W             AL+RMF +FPTTKTYF H DVS GSAQVKAHG 
Sbjct: 1   VLSPEDKNHVRSTWDKIGGHGAEYGAEALERMFTSFPTTKTYFPHFDVSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP 
Sbjct: 61  KVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPAEFTPG 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1819335A|alpha globin
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P19014|HBA_CRIGA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/142 (67%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMFA+FPTTKTYF H DVS GSAQVK+HG
Sbjct: 1   MVLSADDKANIKATWEKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKSHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK L HCLLVTLA H     TP
Sbjct: 61  KKVADALANAAHHLDDLPGALSALSDLHAHKLRVDPVNFKLLGHCLLVTLATHLQAGLTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A HASLDKFLASVSTVLTSKYR
Sbjct: 121 AAHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1111202A|hemoglobin alpha
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K CW             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKNNVKACWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P07403|HBA_SPETO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K CW             AL+RMF +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSPADKNNVKACWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0409270A|hemoglobin alpha
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK NIK  W             AL+R FA+FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>sp|P01953|HBA_MELME Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK NIK  W             AL+R FA+FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>prf|1612430A|hemoglobin alpha
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGA+S LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGAMSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P23600|HBA_MUSLU Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R FA+FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGA+S LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGAMSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01939|HBA2_GALCR Hemoglobin subunit alpha-B (Hemoglobin alpha-B
           chain) (Alpha-B-globin) (Alpha-II).
          Length = 142

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GS QVK HG
Sbjct: 1   MVLSPTDKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSTQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK L HCLLVTLACHHP +FTP
Sbjct: 61  KKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF+ASVSTVLTSKYR
Sbjct: 121 AVHASLDKFMASVSTVLTSKYR 142


Go to top
>tr|A4ZQM9|A4ZQM9_PERLE Hemoglobin alpha subunit 1.
          Length = 142

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK  +K  W             AL RMF + PTTKTYF H  VSPGSAQVKAHG
Sbjct: 1   MVLSAEDKAKVKTVWSKIGGHGADYGAEALGRMFESHPTTKTYFPHFHVSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDL AHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  AKVADALATAANNLDDLPGALSALSDLQAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|Q9TSN8|HBA2_BUBBU Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2-globin) (Ialpha2).
          Length = 142

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+NI+  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNIQAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVANALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|711680A|hemoglobin alpha
          Length = 141

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTNIK  W             A++RMF  FPTTKTYF H D + GS Q+KAHG 
Sbjct: 1   VLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSZQIKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALSTLSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVSEALTKAVGHLDDLPGALSTLSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|0504211A|hemoglobin alpha
          Length = 141

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS QVKAHG 
Sbjct: 1   VLSPADKTNVKTAWNAVGGQAGEHGAEALERMFLSFPTTKTYFPHFDLSHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVSHLDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>sp|P01936|HBA_EULFU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS QVKAHG 
Sbjct: 1   VLSPADKTNVKTAWNAVGGQAGEHGAEALERMFLSFPTTKTYFPHFDLSHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVSHLDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>pdb|1S0H_A|3.00| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  186 bits (472), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>sp|Q9TS34|HBA2_HYLLA Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2- globin).
          Length = 142

 Score =  186 bits (472), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P A + LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNAQTALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P15448|HBA_MELCA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (472), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+R FA+FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPSDKANVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H +DLP ALSTLSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHGDDLPMALSTLSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>prf|732178A|hemoglobin alpha
          Length = 141

 Score =  186 bits (472), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1004272A|hemoglobin alpha
          Length = 141

 Score =  186 bits (472), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P67818|HBA_SAGOE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (472), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0608225A|hemoglobin alpha
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|2D5X_A|1.45| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1IWH_A|1.55| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>prf|0603229A|hemoglobin alpha
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTN+K  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKTNVKTAFGKIGGHAAEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTP+
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P63106|HBA_CAMDR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTN+K  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKTNVKTAFGKIGGHAAEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTP+
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P63105|HBA_CAMBA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTN+K  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKTNVKTAFGKIGGHAAEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTP+
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|Q9TSN7|HBA1_BUBBU Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1-globin) (Ialpha1).
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N++  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVQAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1614252A|hemoglobin alpha
          Length = 141

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSADDK NIK  W             AL+RMFA+FPTTKTYF+H DVS GSAQVK+HG 
Sbjct: 1   VLSADDKANIKATWEKIGGHGAEYGAEALERMFASFPTTKTYFAHFDVSHGSAQVKSHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK L HCLLVTLA H     TPA
Sbjct: 61  KVADALANAAHHLDDLPGALSALSDLHAHKLRVDPVNFKLLGHCLLVTLATHLQAGLTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
            HASLDKFLASVSTVLTSKYR
Sbjct: 121 AHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2706289H|HBA1 gene
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|2706289G|HBA2 gene
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1002273B|globin alpha
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1002273A|globin alpha1
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1Z8U_D|2.40| 4| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN
           STABILIZING PROTE
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1Z8U_B|2.40| 4| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN
           STABILIZING PROTE
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1Y01_B|2.80| 2| 142|M|MOL_ID: 1; MOLECULE: ALPHA-HEMOGLOBIN
           STABILIZING PROTE
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1BZ1_C|1.59| 4| 142|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1BZ1_A|1.59| 4| 142|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q5R9M5|Q5R9M5_PONAB Putative uncharacterized protein
           DKFZp468J1717.
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P69907|HBA_PANTR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P69906|HBA_PANPA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q1HDT5|Q1HDT5_HUMAN Hemoglobin alpha 1-2 hybrid.
          Length = 142

 Score =  186 bits (471), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTKAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1616185A|hemoglobin alpha
          Length = 141

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANIKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P67816|HBA_LAMPA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANIKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P67815|HBA_LAMGU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANIKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01966|HBA_BOVIN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1313206A|hemoglobin
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+AHG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1206295A|hemoglobin alpha
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+AHG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01940|HBA_TARBA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS+QVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++++P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP DFTPA
Sbjct: 61  KVADALTTAVGHIDNMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF+ASVSTVLTSKYR
Sbjct: 121 VHASLDKFVASVSTVLTSKYR 141


Go to top
>sp|P63110|HBA_PANPO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+AHG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|0901252A|hemoglobin alpha
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTNIK  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSSADKTNIKAAWDKVGGNAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01956|HBA_ROUAE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTNIK  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSSADKTNIKAAWDKVGGNAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1010261A|hemoglobin alphaI
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQV+AHG 
Sbjct: 1   VLSPTDKTNVKAAWSKVGSHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVQAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHHPDDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 IHASLDKFLSNVSTVLTSKYR 141


Go to top
>sp|P01962|HBA_TAPTE Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 103/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQV+AHG 
Sbjct: 1   VLSPTDKTNVKAAWSKVGSHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVQAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHHPDDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 IHASLDKFLSNVSTVLTSKYR 141


Go to top
>sp|P09423|HBA_BISBO Hemoglobin subunit alpha-I/II (Hemoglobin
           alpha-I/II chain) (Alpha- I/II-globin).
          Length = 142

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1004272B|hemoglobin alpha
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P18972|HBA_CALAR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGSHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1408162A|hemoglobin alpha
          Length = 141

 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFVSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>prf|1305232A|hemoglobin alpha
          Length = 141

 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D++ GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWDKVGGQAGEYGAEALERMFLSFPTTKTYFPHFDLAHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVGHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ASVSTVLTSKYR
Sbjct: 121 IHASLDKFFASVSTVLTSKYR 141


Go to top
>sp|P09839|HBA_MACCA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D++ GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWDKVGGQAGEYGAEALERMFLSFPTTKTYFPHFDLAHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVGHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ASVSTVLTSKYR
Sbjct: 121 IHASLDKFFASVSTVLTSKYR 141


Go to top
>sp|P10892|HBA_LUTLU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKTNVKSTWDKIGGHAGEYGGEALERTFVSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P01969|HBA_BOSGF Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKGNVKAAWGKVGDHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>sp|P01971|HBA_ALCAA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSATDKSNVKAAWGKVGGNAPAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  EKVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1104186A|hemoglobin alphaI
          Length = 141

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPTDKSNVKAAWEKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP + TPA
Sbjct: 61  KVADALTNAVSHVDDMPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAELTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS DKF+ASVSTVLTSKYR
Sbjct: 121 VHASFDKFMASVSTVLTSKYR 141


Go to top
>prf|0803202A|hemoglobin alpha
          Length = 141

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSTVSTVLTSKYR 141


Go to top
>prf|3324415A|Hb
          Length = 142

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK N+K  W             AL+RMF +FPTTKTYF H DV+ GSAQVKAHG
Sbjct: 1   MVLSPADKANVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDVTHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA KLRVDPVNFK L+HCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTQVVDHLDDLPGALSALSDLHAQKLRVDPVNFKLLAHCLLVTLANHHPNEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>tr|A4GTS5|A4GTS5_OCHCU Hemoglobin alpha chain.
          Length = 142

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK N+K  W             AL+RMF +FPTTKTYF H DV+ GSAQVKAHG
Sbjct: 1   MVLSPADKANVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDVTHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHA KLRVDPVNFK L+HCLLVTLA HHP +FTP
Sbjct: 61  KKVADALTQVVDHLDDLPGALSALSDLHAQKLRVDPVNFKLLAHCLLVTLANHHPNEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|0807251A|globin alphaI
          Length = 141

 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLACH P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|1204171A|hemoglobin alpha
          Length = 141

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQ++ HG 
Sbjct: 1   VLSPADKTNVKAAWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQIQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P08852|HBA_MARMA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQ++ HG 
Sbjct: 1   VLSPADKTNVKAAWEKIGGHGAAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQIQGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALANAAAHVDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK3|A4ZQK3_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANIKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|0803202B|hemoglobin alphaI
          Length = 141

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGNAGDFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSTVSTVLTSKYR 141


Go to top
>sp|P01947|HBA_CAVPO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK N+K  W              L RMF +FPTTKTYF HIDVSPGS  +KAHG
Sbjct: 1   MVLSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTSFPTTKTYFHHIDVSPGSGDIKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP ALSTLSD+HAHKLRVDPVNFKFL+HCLLVTLA H   DFTP
Sbjct: 61  KKVADALTTAVGHLDDLPTALSTLSDVHAHKLRVDPVNFKFLNHCLLVTLAAHLGADFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           ++HASLDKF ASVSTVLTSKYR
Sbjct: 121 SIHASLDKFFASVSTVLTSKYR 142


Go to top
>sp|P06635|HBA_PONPY Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKDHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1004268A|hemoglobin alphaI
          Length = 141

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSQGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01967|HBA1_BOSMU Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 141

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSQGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>tr|A4ZQH1|A4ZQH1_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVL A+DK N+K  W             AL RMF + PTTKTYF H DVSPGSAQVK  G
Sbjct: 1   MVLFAEDKANVKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSPGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVADALATAPDNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q4TU70|Q4TU70_CEREL Alpha hemoglobin chain.
          Length = 142

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 103/142 (72%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKSNVKAAWGKVGGNAPAFGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  EKVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLA+VSTVLTSKYR
Sbjct: 121 AVHASLDKFLANVSTVLTSKYR 142


Go to top
>prf|1414222A|hemoglobin alpha
          Length = 141

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSPSDKANVKATWDKIGGHAGEYGGEALERTFXSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H +DLP ALSTLSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTNAVAHGDDLPMALSTLSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSTVSTVLTSKYR 141


Go to top
>prf|1306240A|hemoglobin alpha
          Length = 141

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPTDKTNVKTAWSHVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H+P DFTPA
Sbjct: 61  KVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHNPQDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>sp|P09906|HBA_RHIUN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPTDKTNVKTAWSHVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H+P DFTPA
Sbjct: 61  KVGDALTQAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLALHNPQDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>prf|671052A|hemoglobin alpha
          Length = 141

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVADGLTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>prf|1501424A|hemoglobin alpha
          Length = 141

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQTHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P18976|HBA_PANPS Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQTHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>sp|P63108|HBA_MACMU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P63107|HBA_MACFU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|A4ZQL1|A4ZQL1_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  184 bits (466), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFESHPTTKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1001193A|globin alpha
          Length = 142

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K  W             AL RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKAAWGKVGAHAGEYGAEALLRMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|2MHB_A|2.0 | 2| 141|N|HEMOGLOBIN (HORSE, AQUO MET)             
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|2DHB_A|2.8 | 2| 141|N|HEMOGLOBIN (HORSE,DEOXY)                 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVADGLTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8K_C|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8K_A|2.30| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8I_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8I_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8H_C|3.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8H_A|3.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAINS; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1NS9_A|1.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1NS6_A|2.05| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1G0B_A|1.90| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1O1P_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 283

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1C7C_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN
           (ALPHA CHAIN); CHA
          Length = 283

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1ABY_A|2.6 | 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, D; ENGINE
          Length = 283

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1ABW_A|2.0 | 5| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN-BASED
           BLOOD SUBSTITUTE;
          Length = 283

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1C7D_A|1.80| 3| 284|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN
           (ALPHA CHAIN); CHA
          Length = 284

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 144 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 203

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 204 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 263

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 264 VHASLDKFLASVSTVLTSKYR 284



Go to top
 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0502223A|hemoglobin alpha
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL RMF A PTTKTYF H D++PGSAQVK HG 
Sbjct: 1   VLSATDKANVKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLNPGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      +++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+V+TVLTSKYR
Sbjct: 121 VHASLDKFLATVATVLTSKYR 141


Go to top
>sp|P01949|HBA_ERIEU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL RMF A PTTKTYF H D++PGSAQVK HG 
Sbjct: 1   VLSATDKANVKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLNPGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      +++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+V+TVLTSKYR
Sbjct: 121 VHASLDKFLATVATVLTSKYR 141


Go to top
>prf|0404172A|hemoglobin alpha
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|2PGH_C|2.8 | 4| 141|N|HEMOGLOBIN (AQUOMET)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|2PGH_A|2.8 | 4| 141|N|HEMOGLOBIN (AQUOMET)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1QPW_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOBIN
           (ALPHA SUBUNIT
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1QPW_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOBIN
           (ALPHA SUBUNIT
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01965|HBA_PIG Hemoglobin subunit alpha (Hemoglobin alpha chain)
           (Alpha-globin).
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|1819219A|hemoglobin
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS+QVK HG 
Sbjct: 1   VLSPADKTNVKAAWEKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HH  DFTPA
Sbjct: 61  KVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHAADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P28780|HBA_TAPGE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS+QVK HG 
Sbjct: 1   VLSPADKTNVKAAWEKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HH  DFTPA
Sbjct: 61  KVGDALGNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHAADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|650772A|hemoglobin alpha
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|620479A|hemoglobin alpha
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2010369A|hemoglobin
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0907233A|hemoglobin alpha
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0703294A|globin alpha 5'
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|6HBW_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: PROTEIN (HEMOGLOBIN
           ALPHA 1); CHAI
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|6HBW_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: PROTEIN (HEMOGLOBIN
           ALPHA 1); CHAI
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|4HHB_C|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|4HHB_A|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|3HHB_A|1.74| 2| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHE_C|2.2 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL B 1
           REPLACED BY MET,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHE_A|2.2 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL B 1
           REPLACED BY MET,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHD_C|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY) (HBA)                 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHD_A|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY) (HBA)                 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHB_C|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HHB_A|1.74| 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HCO_A|2.7 | 2| 141|N|HEMOGLOBIN (CARBONMONOXY)                
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBS_G|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHAIN:
           A, B, C, D, E
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBS_E|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHAIN:
           A, B, C, D, E
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBS_C|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHAIN:
           A, B, C, D, E
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBS_A|2.05| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN S; CHAIN:
           A, B, C, D, E
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBF_A|2.2 | 2| 141|N|HEMOGLOBIN A (N-PROPYL ISCOCYANIDE, PH
           6.7)           
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBE_A|2.0 | 2| 141|N|HEMOGLOBIN A (N-BUTYL ISCOCYANIDE, PH
           6.7)            
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBD_A|2.2 | 2| 141|N|HEMOGLOBIN A (METHYL ISCOCYANIDE, PH 6.7)
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2HBC_A|2.1 | 2| 141|N|HEMOGLOBIN A (ETHYL ISCOCYANIDE, PH 6.7) 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2H35_C|NOT | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2H35_A|NOT | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2DN3_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2DN2_C|1.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2DN2_A|1.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2DN1_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2D60_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2D60_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2D5Z_C|1.45| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|2D5Z_A|1.45| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           SUBUNIT; CHAIN: A
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YZI_A|2.07| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YVT_A|1.80| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YVQ_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YVQ_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YIH_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YIH_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YIE_C|2.40| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YIE_A|2.40| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YHR_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YHR_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YHE_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YHE_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YH9_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YH9_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YGF_C|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YGF_A|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YGD_C|2.73| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YGD_A|2.73| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YG5_C|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YG5_A|2.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YFF_G|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YFF_E|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YFF_C|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YFF_A|2.40| 8| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEV_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEV_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEU_C|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEU_A|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEQ_C|2.75| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEQ_A|2.75| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEO_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEO_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEN_C|2.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YEN_A|2.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE2_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE2_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE1_C|4.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE1_A|4.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE0_C|2.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YE0_A|2.50| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y85_C|2.13| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y85_A|2.13| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y83_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y83_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7Z_C|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7Z_A|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7G_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7G_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7D_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7D_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7C_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y7C_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5K_C|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5K_A|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5J_C|2.03| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5J_A|2.03| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5F_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y5F_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4V_C|1.84| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4V_A|1.84| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4R_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4R_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4Q_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4Q_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4P_C|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4P_A|1.98| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4G_C|1.91| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4G_A|1.91| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4F_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4F_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4B_C|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y4B_A|2.10| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y46_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y46_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y45_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y45_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y35_C|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y35_A|2.12| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y31_C|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y31_A|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y2Z_C|2.07| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y2Z_A|2.07| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y22_C|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y22_A|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y0W_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y0W_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y0T_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y0T_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ2_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ2_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XXT_C|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XXT_A|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1UIW_G|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1UIW_E|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1UIW_C|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1UIW_A|1.50| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1THB_C|1.5 | 4| 141|N|HEMOGLOBIN (T STATE, PARTIALLY
           OXYGENATED)            
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1THB_A|1.5 | 4| 141|N|HEMOGLOBIN (T STATE, PARTIALLY
           OXYGENATED)            
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SI4_C|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SI4_A|2.20| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SHR_C|1.88| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SHR_A|1.88| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SDL_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SDL_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SDK_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1SDK_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQA_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQA_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQ4_C|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQ4_A|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQ3_C|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RQ3_A|1.91| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RPS_C|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RPS_A|2.11| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QXE_C|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QXE_A|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QXD_C|2.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QXD_A|2.25| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QSI_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QSI_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QSH_C|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QSH_A|1.70| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NQP_C|1.73| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NQP_A|1.73| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NIH_C|2.6 | 4| 141|N|ALPHA-NICKELOUS, BETA-FERROUS
           CARBONMONOXY HEMOGLOBIN (
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NIH_A|2.6 | 4| 141|N|ALPHA-NICKELOUS, BETA-FERROUS
           CARBONMONOXY HEMOGLOBIN (
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NEJ_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1NEJ_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1MKO_C|2.18| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1MKO_A|2.18| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1M9P_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1M9P_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LJW_A|2.16| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFZ_A|3.10| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFY_A|3.30| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFV_A|2.80| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFT_A|2.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFQ_A|2.60| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFL_R|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFL_P|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFL_C|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1LFL_A|2.70| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1KD2_C|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1KD2_A|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1K1K_A|2.00| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1K0Y_C|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1K0Y_A|1.87| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_W|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_U|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_R|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_P|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_C|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1JY7_A|3.20|12| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J41_G|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J41_E|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J41_C|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J41_A|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J40_G|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J40_E|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J40_C|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J40_A|1.45| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Z_G|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Z_E|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Z_C|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Z_A|1.60| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Y_G|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Y_E|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Y_C|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J3Y_A|1.55| 8| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1IRD_A|1.25| 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HHO_A|2.1 | 2| 141|N|HEMOGLOBIN A (OXY)                       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGC_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, ALPHA-OXY)          
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGC_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, ALPHA-OXY)          
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGB_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, AQUOMET)            
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGB_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, AQUOMET)            
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGA_C|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, DEOXYGENATED)       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HGA_A|2.1 | 4| 141|N|HEMOGLOBIN (T STATE, DEOXYGENATED)       
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HDB_C|2.2 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY)
           BETA-V67T; CHAI
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HDB_A|2.2 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY)
           BETA-V67T; CHAI
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HCO_A|2.7 | 2| 141|N|HEMOGLOBIN (CARBONMONOXY)                
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBS_G|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBS_E|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBS_C|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBS_A|3.0 | 8| 141|N|HEMOGLOBIN S (DEOXY)                     
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBB_C|1.9 | 4| 141|N|HEMOGLOBIN A (DEOXY, LOW SALT, 100MM CL) 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBB_A|1.9 | 4| 141|N|HEMOGLOBIN A (DEOXY, LOW SALT, 100MM CL) 
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBA_C|2.1 | 4| 141|N|HEMOGLOBIN ROTHSCHILD (DEOXY)            
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HBA_A|2.1 | 4| 141|N|HEMOGLOBIN ROTHSCHILD (DEOXY)            
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HAC_C|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HAC_A|2.60| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HAB_C|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HAB_A|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GZX_C|2.1 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GZX_A|2.1 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GBV_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GBV_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GBU_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GBU_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1G9V_C|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1G9V_A|1.85| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1FN3_C|2.48| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1FN3_A|2.48| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1FDH_A|2.5 | 2| 141|N|HEMOGLOBIN (DEOXY, HUMAN FETAL F=/II$=)  
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXV_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1
           REPLACED BY ALA IN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXV_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1
           REPLACED BY ALA IN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXU_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1
           REPLACED BY MET IN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXU_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH VAL 1
           REPLACED BY MET IN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXT_C|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH ADDITIONAL
           MET AT THE N-
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DXT_A|1.8 | 4| 141|M|HEMOGLOBIN (DEOXY) MUTANT WITH ADDITIONAL
           MET AT THE N-
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DKE_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN: ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1DKE_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN: ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1COH_C|2.9 | 4| 141|N|ALPHA-FERROUS-CARBONMONOXY,
           BETA-COBALTOUS-DEOXY HEMOGL
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1COH_A|2.9 | 4| 141|N|ALPHA-FERROUS-CARBONMONOXY,
           BETA-COBALTOUS-DEOXY HEMOGL
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1CMY_C|3.0 | 4| 141|N|HEMOGLOBIN YPSILANTI (CARBON MONOXY FORM)
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1CMY_A|3.0 | 4| 141|N|HEMOGLOBIN YPSILANTI (CARBON MONOXY FORM)
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1CLS_C|1.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1CLS_A|1.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BZ0_C|1.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BZ0_A|1.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BUW_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; SYNONYM:
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BUW_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; SYNONYM:
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BIJ_C|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BIJ_A|2.3 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN A; CHAIN:
           A, B, C, D; O
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BBB_C|1.7 | 4| 141|N|HEMOGLOBIN A (R2 STATE, CARBONMONOXY)    
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BBB_A|1.7 | 4| 141|N|HEMOGLOBIN A (R2 STATE, CARBONMONOXY)    
                       
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1B86_C|2.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; MOL_ID: 2
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1B86_A|2.50| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; MOL_ID: 2
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A9W_C|2.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, E, C, F; ENG
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A9W_A|2.9 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, E, C, F; ENG
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A3N_C|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; BIO
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A3N_A|1.8 | 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; BIO
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A0Z_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A0Z_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A0U_C|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A0U_A|2.14| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A01_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A01_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A00_C|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A00_A|2.0 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN A;
           CHAIN: A, B, C,
          Length = 141

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BAB_C|1.5 | 4| 142|M|HEMOGLOBIN THIONVILLE ALPHA CHAIN MUTANT
           WITH VAL 1 REP
          Length = 142

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MELSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1BAB_A|1.5 | 4| 142|M|HEMOGLOBIN THIONVILLE ALPHA CHAIN MUTANT
           WITH VAL 1 REP
          Length = 142

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MELSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|671045A|hemoglobin alpha
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1HDA_C|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1HDA_A|2.2 | 4| 141|N|HEMOGLOBIN (DEOXY)                       
                       
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G0A_C|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G0A_A|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G09_C|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G09_A|2.04| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G08_C|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1G08_A|1.90| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1FSX_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1FSX_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1IBE_A|1.8 | 2| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (DEOXY);
           CHAIN: A, B; B
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/141 (66%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LS+LHAHKLRVDPVNFK LSHCLL TLA H P DFTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>sp|P21768|HBA_MACSI Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K+ W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1203228A|hemoglobin alpha
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANVKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL +VSTVLTSKYR
Sbjct: 121 VHASLDKFLTNVSTVLTSKYR 141


Go to top
>sp|P07425|HBA_LAMVI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANVKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL +VSTVLTSKYR
Sbjct: 121 VHASLDKFLTNVSTVLTSKYR 141


Go to top
>prf|1412195A|hemoglobin alpha
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK+N+K  W             AL+RMF +FPTTKTYF H D++ GS+QVKAHG 
Sbjct: 1   VLSSTDKSNVKAAWDKVGGHVGEYGAEALERMFLSFPTTKTYFPHFDLAHGSSQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P14389|HBA_PTEAL Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK+N+K  W             AL+RMF +FPTTKTYF H D++ GS+QVKAHG 
Sbjct: 1   VLSSTDKSNVKAAWDKVGGHVGEYGAEALERMFLSFPTTKTYFPHFDLAHGSSQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|Q53F97|Q53F97_HUMAN Alpha 2 globin variant (Fragment).
          Length = 142

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKT++K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTHVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|1004268B|hemoglobin alphaII
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01968|HBA2_BOSMU Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2- globin).
          Length = 141

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|Q862A7|HBA_PIPAB Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 143

 Score =  182 bits (463), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 104/143 (72%), Gaps = 1/143 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHI-DVSPGSAQVKAH 59
           MVLS  DKTN+K  W             AL+RMF +FPTTKTYF H  D+S GSAQVKAH
Sbjct: 1   MVLSPADKTNVKAAWDKVGGHAGDYGAEALERMFLSFPTTKTYFPHFSDLSHGSAQVKAH 60

Query: 60  GXXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFT 119
           G            H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLACHHP +FT
Sbjct: 61  GKKVGDALNNAVGHMDDLPTALSALSDLHAHKLRVDPVNFKLLSHCLLVTLACHHPAEFT 120

Query: 120 PAMHASLDKFLASVSTVLTSKYR 142
           PA+HASLDKFLA+VSTVL SKYR
Sbjct: 121 PAVHASLDKFLANVSTVLVSKYR 143


Go to top
>prf|610524A|hemoglobin alpha
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01923|HBA_GORGO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2711193A|Hb
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSATDKSNVKAAWGKVGGNAPAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLAAHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|1412195B|hemoglobin alpha
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK+N+K  W             AL+RMF +FPTTKTYF H D++ GS+QVKAHG 
Sbjct: 1   VLSSTDKSNVKAAWDKVGGNVGEYGAEALERMFLSFPTTKTYFPHFDLAHGSSQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P14390|HBA_PTEPO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 104/141 (73%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK+N+K  W             AL+RMF +FPTTKTYF H D++ GS+QVKAHG 
Sbjct: 1   VLSSTDKSNVKAAWDKVGGNVGEYGAEALERMFLSFPTTKTYFPHFDLAHGSSQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVGHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1012236A|hemoglobin alphaE
          Length = 141

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSATDKSNVKAAWGKVGGNAPAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLAAHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01926|HBA_CERAE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|Q9TSN9|HBA3_BUBBU Hemoglobin subunit alpha-3 (Hemoglobin alpha-3
           chain) (Alpha-3-globin) (IIalpha3).
          Length = 142

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 102/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK+N++  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSAADKSNVQAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTP
Sbjct: 61  AKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF A+VSTVLTSKYR
Sbjct: 121 AVHASLDKFFANVSTVLTSKYR 142


Go to top
>sp|P10883|HBA_PANTS Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (463), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQTHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ +LP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINNLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>tr|A4ZQI9|A4ZQI9_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 102/142 (71%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01929|HBA_SAGFU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVADALTVAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0407252A|hemoglobin alpha
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANIKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           + ASLDKFLA+VSTVLTSKYR
Sbjct: 121 VDASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P01973|HBA_LAMGL Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  +             AL+RMF  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSKDKANIKTAFGKIGGHAADYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVT+A HHPGDFTPA
Sbjct: 61  KVGDALTKAADHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           + ASLDKFLA+VSTVLTSKYR
Sbjct: 121 VDASLDKFLANVSTVLTSKYR 141


Go to top
>sp|Q7M3B6|HBA_SAGMY Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                       V+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DFTPA
Sbjct: 61  KVADALTNAVALVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1509322A|hemoglobin alpha
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P21767|HBA_MACFA Hemoglobin subunit alpha-A/Q/R/T (Hemoglobin
           alpha-A/Q/R/T chain) (Alpha-A/Q/R/T-globin).
          Length = 141

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1206221A|hemoglobin alphaI
          Length = 141

 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGDHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|1008176A|hemoglobin alpha
          Length = 141

 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGDHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPNDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|1706193A|hemoglobin alpha
          Length = 141

 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKAAWGKVGGNAPAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>sp|P21379|HBA_RANTA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  182 bits (462), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKSNVKAAWGKVGGNAPAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1O1K_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1K_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7W_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7W_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1C7B_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN
           (ALPHA CHAIN); CHA
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1C7B_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN
           (ALPHA CHAIN); CHA
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BZZ_C|1.59| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1BZZ_A|1.59| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1O_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KLADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1O_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KLADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0404170A|hemoglobin alphaI
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKDHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1AJ9_A|2.2 | 2| 141|M|MOL_ID: 1; MOLECULE: CARBOXYHEMOGLOBIN;
           CHAIN: A, B; SY
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS+QVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSSQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1105218A|hemoglobin alpha
          Length = 141

 Score =  182 bits (461), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK ++K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGHVKAAWGKVGSHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H PGDFTPA
Sbjct: 61  KVAAALTKAVDHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>prf|0603229B|hemoglobin alpha
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W              L RMF +FPTTKTYF HIDVSPGS  +KAHG 
Sbjct: 1   VLSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTSFPTTKTYFHHIDVSPGSGDIKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALSTLSD+HAHKLRVDPVNFKFL+HCLLVTLA H   DFTP+
Sbjct: 61  KVADALTTAVGHLDDLPTALSTLSDVHAHKLRVDPVNFKFLNHCLLVTLAAHLGADFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ASVSTVLTSKYR
Sbjct: 121 IHASLDKFFASVSTVLTSKYR 141


Go to top
>prf|1211215B|hemoglobin alphaII
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+ W             AL+RMF +FP TKTYF H D+S GSAQ+K HG 
Sbjct: 1   VLSPADKNNVKSAWKAIGSHAGEHGAEALERMFLSFPPTKTYFPHFDLSHGSAQIKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVNHIDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>sp|P20019|HBA2_LEMVA Hemoglobin subunit alpha-2 (Hemoglobin alpha-2
           chain) (Alpha-2-globin) (Hemoglobin alpha-II chain).
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+ W             AL+RMF +FP TKTYF H D+S GSAQ+K HG 
Sbjct: 1   VLSPADKNNVKSAWKAIGSHAGEHGAEALERMFLSFPPTKTYFPHFDLSHGSAQIKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVNHIDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>prf|1211215A|hemoglobin alphaI
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+ W             AL+RMF +FP TKTYF H D+S GSAQ+K HG 
Sbjct: 1   VLSPADKNNVKSAWNAIGSHAGEHGAEALERMFLSFPPTKTYFPHFDLSHGSAQIKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVNHIDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>sp|P20018|HBA1_LEMVA Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1-globin) (Hemoglobin alpha-I chain).
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K+ W             AL+RMF +FP TKTYF H D+S GSAQ+K HG 
Sbjct: 1   VLSPADKNNVKSAWNAIGSHAGEHGAEALERMFLSFPPTKTYFPHFDLSHGSAQIKTHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALTNAVNHIDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFAAVSTVLTSKYR 141


Go to top
>prf|1805193A|hemoglobin
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKANVKAAWDKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HH  +FTPA
Sbjct: 61  KVGDALSNAAGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHAAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>sp|P24659|HBA_MACGG Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin) (Hemoglobin
           alpha-I/II chain).
          Length = 141

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSPADKANVKAAWDKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HH  +FTPA
Sbjct: 61  KVGDALSNAAGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLASHHAAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>prf|701209A|hemoglobin alpha
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|681081A|hemoglobin alpha
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|671047A|hemoglobin Aalpha
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKSNVKAAWGKVGADAGGYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGE 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPG LS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPDDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HA LDKFL SV+TVLTSKYR
Sbjct: 121 VHAELDKFLGSVNTVLTSKYR 141


Go to top
>prf|731916A|hemoglobin alpha
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHGGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01924|HBA_SEMEN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHGGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P21766|HBA_MACAS Hemoglobin subunit alpha-1/2/3 (Hemoglobin
           alpha-1/2/3 chain) (Alpha- 1/2/3-globin).
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1804207A|hemoglobin
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL R F +FPTTKTYF H+D++PGSA + AHG 
Sbjct: 1   VLSAADKANVKAVWEKAGGNVGKYGGEALDRTFLSFPTTKTYFPHMDLTPGSADIMAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACH  GDFTPA
Sbjct: 61  KVADALTLAVGHMDDLPGALSKLSDLHAYKLRVDPVNFKLLSHCLLVTLACHLGGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
            HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AHASLDKFLSSVSTVLTSKYR 141


Go to top
>sp|P24291|HBA_ECHTE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL R F +FPTTKTYF H+D++PGSA + AHG 
Sbjct: 1   VLSAADKANVKAVWEKAGGNVGKYGGEALDRTFLSFPTTKTYFPHMDLTPGSADIMAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLACH  GDFTPA
Sbjct: 61  KVADALTLAVGHMDDLPGALSKLSDLHAYKLRVDPVNFKLLSHCLLVTLACHLGGDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
            HASLDKFL+SVSTVLTSKYR
Sbjct: 121 AHASLDKFLSSVSTVLTSKYR 141


Go to top
>prf|1702181A|hemoglobin alpha
          Length = 141

 Score =  181 bits (459), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+EDLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +H++LDKF ++VSTVLTSKYR
Sbjct: 121 VHSALDKFFSAVSTVLTSKYR 141


Go to top
>sp|P19645|HBA_PAGLA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  181 bits (459), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 102/141 (72%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  W             AL+R F +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+EDLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +H++LDKF ++VSTVLTSKYR
Sbjct: 121 VHSALDKFFSAVSTVLTSKYR 141


Go to top
>sp|P11753|HBA_CYNSP Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  181 bits (459), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D++ GS QVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGNAGEYGAEALERMFLSFPTTKTYFPHFDLAHGSPQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVSHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1N_A|1.80| 3| 285|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 285

 Score =  181 bits (459), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 204

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 205 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 264

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 265 VHASLDKFLASVSTVLTSKYR 285



Go to top
 Score =  180 bits (456), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1202213A|Hb alpha
          Length = 141

 Score =  181 bits (459), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P07402|HBA_MACSP Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin).
          Length = 141

 Score =  181 bits (459), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|Q7M3B8|HBA1_HAPGR Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 140

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 102/141 (72%), Gaps = 1/141 (0%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTNIK  W             AL+RMF +FPTTKTYF H D+S GS Q+ AHG 
Sbjct: 1   VLSSADKTNIKTAWGAIGSHAADHGAEALERMFLSFPTTKTYFPHFDMSHGSGQI-AHGK 59

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 60  KVADALTNAVGHIDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPA 119

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 120 VHASLDKFFAAVSTVLTSKYR 140


Go to top
>prf|770504A|hemoglobin alpha
          Length = 141

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  +             AL+RMF  FPTTKTYF H ++S GS QVKAHG 
Sbjct: 1   VLSAADKANVKAAYGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA HHP DF P+
Sbjct: 61  KVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 VHASLDKFLANVSTVLTSKYR 141


Go to top
>pdb|1A3O_C|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; MUT
          Length = 141

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKT+F H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTHFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1A3O_A|1.8 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; MUT
          Length = 141

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKT+F H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTHFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQG8|A4ZQG8_PERMA Hemoglobin alpha subunit 1.
          Length = 142

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>pdb|1Y0D_C|2.10| 4| 140|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 140

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 100/140 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKY 141
           +HASLDKFLASVSTVLTSKY
Sbjct: 121 VHASLDKFLASVSTVLTSKY 140


Go to top
>pdb|1Y0D_A|2.10| 4| 140|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 140

 Score =  181 bits (458), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 100/140 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKY 141
           +HASLDKFLASVSTVLTSKY
Sbjct: 121 VHASLDKFLASVSTVLTSKY 140


Go to top
>prf|0510161A|hemoglobin alphaI
          Length = 141

 Score =  180 bits (457), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVDHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>sp|P19002|HBA_MACNE Hemoglobin subunit alpha-1/2/3 (Hemoglobin
           alpha-1/2/3 chain) (Alpha- 1/2/3-globin).
          Length = 141

 Score =  180 bits (457), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVDHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>pdb|1VWT_C|1.9 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  180 bits (457), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDP NFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPWNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1VWT_A|1.9 | 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B, C, D; SYN
          Length = 141

 Score =  180 bits (457), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDP NFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPWNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1RVW_A|2.5 | 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B; SYNONYM:
          Length = 141

 Score =  180 bits (457), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDP NFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPWNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|731485A|hemoglobin alpha
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1R1Y_C|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRV PVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVAPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1R1Y_A|1.80| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRV PVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVAPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1R1X_A|2.15| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRV PVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVAPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQM2|A4ZQM2_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 95/142 (66%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVL ADDK NIK  W             AL RMF +FPTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLPADDKANIKAAWSKIGVHHAEYGAEALGRMFCSFPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1YDZ_C|3.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141


Go to top
>pdb|1YDZ_A|3.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141


Go to top
>pdb|1Y0C_C|2.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141


Go to top
>pdb|1Y0C_A|2.30| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK+R
Sbjct: 121 VHASLDKFLASVSTVLTSKFR 141


Go to top
>tr|Q3LRX5|Q3LRX5_PONPY Alpha globin a3.
          Length = 142

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DKTN+K                AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKTNVKTACRKVRAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALINAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P04237|HBA_TRAST Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 140

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/140 (65%), Positives = 101/140 (72%)

Query: 3   LSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGXX 62
           LSA DK ++K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG  
Sbjct: 1   LSAADKGHVKAAWGKVGSHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAK 60

Query: 63  XXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPAM 122
                     H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H PGDFTPA+
Sbjct: 61  VAAALTKAVDHLDDLPGALSDLSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPGDFTPAV 120

Query: 123 HASLDKFLASVSTVLTSKYR 142
           HASLDKFLA+VSTVLTSKYR
Sbjct: 121 HASLDKFLANVSTVLTSKYR 140


Go to top
>sp|P18978|HBA_TURTR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  180 bits (456), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF  FP+TKTYFSH D+  GSAQ+K HG 
Sbjct: 1   VLSPADKTNVKGTWSKIGNHSAEYGAEALERMFINFPSTKTYFSHFDLGHGSAQIKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+++LP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFTP+
Sbjct: 61  KVADALTKAVGHIDNLPDALSELSDLHAHKLRVDPVNFKLLSHCLLVTLALHLPADFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ5_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (456), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHK RVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKARVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ5_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (456), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHK RVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKARVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XY0_C|1.99| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (456), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTT TYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTGTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XY0_A|1.99| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  180 bits (456), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTT TYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTGTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1J_A|1.90| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 283

 Score =  180 bits (456), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1O1M_A|1.85| 3| 285|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 285

 Score =  179 bits (455), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 145 VLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 204

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 205 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 264

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 265 VHASLDKFLASVSTVLTSKYR 285



Go to top
 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0510161B|hemoglobin alphaII
          Length = 141

 Score =  179 bits (455), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVDHVDDMPHALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>pdb|1XZU_C|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (455), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRV PVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVGPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZU_A|2.16| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (455), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRV PVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVGPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2722305D|Hb
          Length = 141

 Score =  179 bits (454), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTY  H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAADYGAEALERMFLSFPTTKTYPPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|764140A|hemoglobin alpha
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKSNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P +L+ LSDLHAHKLRVDPVNFK L HCLLVTLA H P DFTPA
Sbjct: 61  KVADALTVAVAHVDDMPNSLTALSDLHAHKLRVDPVNFKLLGHCLLVTLAAHLPADFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQL5|A4ZQL5_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIDGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQH7|A4ZQH7_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF +FPTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFCSFPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLQVTLARHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GLI_C|2.5 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN;
           CHAIN: A, B, C, D
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FP TKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPWTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1GLI_A|2.5 | 4| 141|M|MOL_ID: 1; MOLECULE: DEOXYHEMOGLOBIN;
           CHAIN: A, B, C, D
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FP TKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPWTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZV_C|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVD VNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDAVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZV_A|2.11| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVD VNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDAVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1409215A|hemoglobin alpha
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS Q+KAHG 
Sbjct: 1   VLSDEDKTNVKTFWGKIGTHTGEYGGEALERMFLSFPTTKTYFPHFDLSHGSGQIKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+EDLPG LS LSDLHAH+LRVDPVNFK LSHCLLVTL+ H   DFTP+
Sbjct: 61  KVADALTRAVGHLEDLPGTLSELSDLHAHRLRVDPVNFKLLSHCLLVTLSSHLREDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>pdb|1Y8W_C|2.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKL VDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y8W_A|2.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKL VDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ7_C|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKL VDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ7_A|1.90| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKL VDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P07414|HBA_TRIIN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS Q+KAHG 
Sbjct: 1   VLSDEDKTNVKTFWGKIGTHTGEYGGEALERMFLSFPTTKTYFPHFDLSHGSGQIKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+EDLPG LS LSDLHAH+LRVDPVNFK LSHCLLVTL+ H   DFTP+
Sbjct: 61  KVADALTRAVGHLEDLPGTLSELSDLHAHRLRVDPVNFKLLSHCLLVTLSSHLREDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>prf|1402398A|hemoglobin alpha
          Length = 140

 Score =  179 bits (453), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 102/141 (72%), Gaps = 1/141 (0%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTK YF H D+S GSAQV+AHG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTK-YFPHFDLSHGSAQVQAHGQ 59

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLP ALS LSDLHA+KLRVDPVNFKFLSHCLLVTLACHHP +FTPA
Sbjct: 60  KVADALTKAVVHINDLPNALSDLSDLHAYKLRVDPVNFKFLSHCLLVTLACHHPEEFTPA 119

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 120 VHASLDKFFSAVSTVLTSKYR 140


Go to top
>pdb|1O1L_A|1.80| 3| 283|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 283

 Score =  179 bits (453), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 143 VLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 202

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 203 KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 262

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 263 VHASLDKFLASVSTVLTSKYR 283



Go to top
 Score =  177 bits (450), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAWERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y09_C|2.25| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (453), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPV FK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVAFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y09_A|2.25| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  179 bits (453), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPV FK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVAFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01932|HBA_THEGE Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  179 bits (453), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS DDK ++K+ W             AL+RMF +FPTTKTYF H D+S GS QVK HG 
Sbjct: 1   VLSPDDKKHVKDAWGKVGEHAGQYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVKKHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2722305B|Hb
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK NI+  W             AL+RMF +FPTTKTY  H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNIQAAWGKVGGHAADYGAEALERMFLSFPTTKTYPPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVANALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1Y0A_C|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK R
Sbjct: 121 VHASLDKFLASVSTVLTSKAR 141


Go to top
>pdb|1Y0A_A|2.22| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSK R
Sbjct: 121 VHASLDKFLASVSTVLTSKAR 141


Go to top
>pdb|1XZ4_C|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKT F H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XZ4_A|2.00| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKT F H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XYE_C|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKT F H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1XYE_A|2.13| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A,
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             AL+RMF +FPTTKT F H D+S GSAQVK HG 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTAFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQG9|A4ZQG9_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANIKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1309192A|hemoglobin alpha
          Length = 141

 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D++ GS QVK HG 
Sbjct: 1   VLSPADKTNVKAAWDKVGGNAGEYGAEALERMFLSFPTTKTYFPHFDLAHGSPQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK LSHCLLVTLA H P DFTPA
Sbjct: 61  KVGDALTNAVSHIDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLANHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTS YR
Sbjct: 121 VHASLDKFLASVSTVLTSLYR 141


Go to top
>pdb|1O1I_A|2.30| 2| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA
           CHAIN; CHAIN: A;
          Length = 141

 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAFERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1505265A|hemoglobin alpha
          Length = 141

 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK N+K CW             AL+R F +FPTTKTYF H D+S GSAQV+ HG 
Sbjct: 1   VLSSADKNNVKACWGKIGSHAGEYGAEALERTFCSFPTTKTYFPHFDLSHGSAQVQTHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ +LP ALS LSDLHA+KLRVDPVN KFLSHCLLVTLACHHP +FTPA
Sbjct: 61  KVADALTKAVAHINNLPNALSDLSDLHAYKLRVDPVNPKFLSHCLLVTLACHHPEEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF ++VSTVLTSKYR
Sbjct: 121 VHASLDKFFSAVSTVLTSKYR 141


Go to top
>tr|A4ZQL9|A4ZQL9_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  178 bits (452), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL+RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALERMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS L DLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALGDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2722305A|Hb
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N++  W             AL+RMF +FPTTKTY  H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVQAAWGKVGGHAADYGAEALERMFLSFPTTKTYPPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1509220A|hemoglobin alpha
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK ++K  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSAADKAHVKAFWTKIGGHAGEYGGEALERTFLSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK L HC+LVTLA HHP  FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLGHCVLVTLALHHPDAFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF+ +VSTVLTSKYR
Sbjct: 121 VHASLDKFITTVSTVLTSKYR 141


Go to top
>sp|P14525|HBA_BRATR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK ++K  W             AL+R F +FPTTKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSAADKAHVKAFWTKIGGHAGEYGGEALERTFLSFPTTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK L HC+LVTLA HHP  FTPA
Sbjct: 61  KVGDALTLAVGHLDDLPGALSDLSDLHAHKLRVDPVNFKLLGHCVLVTLALHHPDAFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF+ +VSTVLTSKYR
Sbjct: 121 VHASLDKFITTVSTVLTSKYR 141


Go to top
>pdb|1QI8_C|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1QI8_A|1.80| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7Y_C|1.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7Y_A|1.70| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7S_C|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1J7S_A|2.20| 4| 141|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, C; FRAGMENT:
          Length = 141

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           +LS  DKTN+K  W             A +RMF +FPTTKTYF H D+S GSAQVK  G 
Sbjct: 1   MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A9L8T9|A9L8T9_PAPAN Hemoglobin, alpha 1 (Predicted).
          Length = 142

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS DDK ++K  W             AL+RMF +FPTTKTYF H D+S GS QV  HG
Sbjct: 1   MVLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVNKHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P63112|HBA_PAPCY Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS DDK ++K  W             AL+RMF +FPTTKTYF H D+S GS QV  HG
Sbjct: 1   MVLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVNKHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P63111|HBA_PAPAN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS DDK ++K  W             AL+RMF +FPTTKTYF H D+S GS QV  HG
Sbjct: 1   MVLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVNKHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>tr|Q9CY10|Q9CY10_MOUSE 13 days embryo liver cDNA, RIKEN full-length
           enriched library, clone:2510040B16 product:hemoglobin,
           beta adult major chain, full insert sequence.
          Length = 142

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%)

Query: 29  ALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGXXXXXXXXXXXXHVEDLPGALSTLSDLH 88
           AL+RMFA+FPTTKTYF H DVS GSAQVK HG            H++DLPGALS LSDLH
Sbjct: 29  ALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANAAGHLDDLPGALSALSDLH 88

Query: 89  AHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPAMHASLDKFLASVSTVLTSKYR 142
           AHKLRVDPVNFK LSHCLLVTLA HHP DFTPA+HASLDKFLASVSTVLTSKYR
Sbjct: 89  AHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR 142


Go to top
>sp|P14259|HBA1_GALCR Hemoglobin subunit alpha-A (Hemoglobin alpha-A
           chain) (Alpha-A-globin) (Alpha-I).
          Length = 142

 Score =  177 bits (450), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 100/142 (70%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+ +K  W             AL+RMF +FPTTKTYF   D+S GSAQVK HG
Sbjct: 1   MVLSPTDKSIVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPQFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKL VDPVNFK LSHCLLVTLACH P +FTP
Sbjct: 61  KKVADALTNAVLHVDDMPSALSALSDLHAHKLTVDPVNFKLLSHCLLVTLACHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF+ASVSTVLTSKYR
Sbjct: 121 AVHASLDKFMASVSTVLTSKYR 142


Go to top
>prf|1504343A|alpha globin
          Length = 143

 Score =  177 bits (449), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 102/143 (71%), Gaps = 1/143 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS  DK+N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG
Sbjct: 1   MVLSPADKSNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALS-TLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFT 119
                       HV+D+P ALS  LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FT
Sbjct: 61  KKVADDLTLAVGHVDDMPHALSKALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFT 120

Query: 120 PAMHASLDKFLASVSTVLTSKYR 142
           PA+HASLDKFLASVSTVLTSKYR
Sbjct: 121 PAVHASLDKFLASVSTVLTSKYR 143


Go to top
>tr|A4ZQJ4|A4ZQJ4_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  177 bits (449), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANIKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKHLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQL6|A4ZQL6_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  177 bits (449), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL R F + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRTFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AEVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK0|A4ZQK0_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  177 bits (449), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MV+SA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVVSAEDKANVKTVWSKIGDHHAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1008177A|hemoglobin alpha
          Length = 141

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DKTN+K  W             AL+RMF +FPTTKTYF H D+  GS QVKAHG 
Sbjct: 1   VLSDNDKTNVKATWSKVGDHASDYVAEALERMFFSFPTTKTYFPHFDLGHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P +FTP 
Sbjct: 61  KVGEALTQAVGHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLSSHQPTEFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>prf|0709565A|globin alpha2 mutant
          Length = 141

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGGYGAGALGRMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0605225A|globin alpha
          Length = 141

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGGYGAGALGRMFLSFPTTKTYFPHFDLSHGSAQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01955|HBA_LOXAF Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS +DKTN+K  W             AL+RMF +FPTTKTYF H D+  GS QVKAHG 
Sbjct: 1   VLSDNDKTNVKATWSKVGDHASDYVAEALERMFFSFPTTKTYFPHFDLGHGSGQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P +FTP 
Sbjct: 61  KVGEALTQAVGHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLSSHQPTEFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>tr|A4ZQK5|A4ZQK5_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (447), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQJ0|A4ZQJ0_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (447), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK4|A4ZQK4_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (447), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0808262A|hemoglobin alpha
          Length = 141

 Score =  176 bits (446), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS QVK HG 
Sbjct: 1   VLSDKDKTNVKATWSKVGDHASDYVAEALERMFFSFPTTKTYFPHFDLSHGSGQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P +FTP 
Sbjct: 61  KVGEALTQAVGHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLSSHQPTEFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>sp|P01954|HBA_ELEMA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  176 bits (446), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GS QVK HG 
Sbjct: 1   VLSDKDKTNVKATWSKVGDHASDYVAEALERMFFSFPTTKTYFPHFDLSHGSGQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P +FTP 
Sbjct: 61  KVGEALTQAVGHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLSSHQPTEFTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL++VSTVLTSKYR
Sbjct: 121 VHASLDKFLSNVSTVLTSKYR 141


Go to top
>prf|1205199A|hemoglobin alphaII
          Length = 141

 Score =  176 bits (446), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FP+TKTYFSH D+   S QVK HG 
Sbjct: 1   VLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++ LP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H PGDFTP+
Sbjct: 61  KVADALTKAVGHLDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P09904|HBA_PHYCA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  176 bits (446), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FP+TKTYFSH D+   S QVK HG 
Sbjct: 1   VLSPADKTNVKAAWAKVGNHAADFGAEALERMFMSFPSTKTYFSHFDLGHNSTQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++ LP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H PGDFTP+
Sbjct: 61  KVADALTKAVGHLDTLPDALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPGDFTPS 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK2|A4ZQK2_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (446), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANIKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQM3|A4ZQM3_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (445), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK NIK  W             AL RMF + PT KTYF H DVS GSAQVK  G
Sbjct: 1   MVLSADDKANIKAAWGKIGGHGAEYGAEALGRMFESHPTIKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01933|HBA_CERTO Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  176 bits (445), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS DDK ++K  W             AL+RMF +FPTTKTYF H ++S GS QVK HG 
Sbjct: 1   VLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFNLSHGSDQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPHALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0605162A|hemoglobin alpha
          Length = 141

 Score =  176 bits (445), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS DDK ++K  W             AL+RMF +FPTTKTYF H D+S GS QV  HG 
Sbjct: 1   VLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVNKHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQM7|A4ZQM7_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  176 bits (445), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + P TKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPNTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1406207A|hemoglobin alphaI
          Length = 141

 Score =  176 bits (445), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+RMF +FPTTKTYF H ++S GS QVK HG 
Sbjct: 1   VLSPADKKNVKAAWDKVGGHAGEYGAEALERMFLSFPTTKTYFPHFNLSHGSDQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P08258|HBA_MANSP Hemoglobin subunit alpha-1/2 (Hemoglobin
           alpha-1/2 chain) (Alpha-1/2- globin) (Hemoglobin
           alpha-I/II chain).
          Length = 141

 Score =  176 bits (445), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DK N+K  W             AL+RMF +FPTTKTYF H ++S GS QVK HG 
Sbjct: 1   VLSPADKKNVKAAWDKVGGHAGEYGAEALERMFLSFPTTKTYFPHFNLSHGSDQVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTPA
Sbjct: 61  KVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASVSTVLTSKYR
Sbjct: 121 VHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|2722305C|Hb
          Length = 141

 Score =  175 bits (444), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N++  W             AL+RMF +FPTTKTY  H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVQAAWGKVGGHAADYGAEALERMFLSFPTTKTYPPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P DFTPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 121 VHASLDKFFANVSTVLTSKYR 141


Go to top
>tr|A4ZQG6|A4ZQG6_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  175 bits (444), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MV+SA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVVSAEDKANVKTVWSKIGDHHAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK8|A4ZQK8_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  175 bits (444), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSAEDKANVKTAWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRV+PVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVNPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQL3|A4ZQL3_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RM  + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHGAEYGAEALGRMLESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQK6|A4ZQK6_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSAEDKANVKAVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRV+PVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVNPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P01935|HBA3_PANTR Hemoglobin subunit alpha-3 (Hemoglobin alpha-2
           chain) (Alpha-3- globin).
          Length = 141

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSA+VK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGZYGAEALERMFLSFPTTKTYFPHFDLSHGSAZVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+P ALS LSBLHAHKLRVBPV+FK L+HCLLVTLA   P +FTPA
Sbjct: 61  KVAKALSBAVZHLDDMPNALSALSBLHAHKLRVBPVBFKLLNHCLLVTLAABFPSZFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+DKFLASVSTVLTSKYR
Sbjct: 121 VHASVDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQJ7|A4ZQJ7_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MV+SA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVVSAEDKANVKTVWSKIGDHHAEYGAEALGRMFESHPTTKTYFLHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D PGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVTDALATAADNLDDQPGALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|Q9XSN2|HBA1_EQUGR Hemoglobin subunit alpha-1 (Hemoglobin alpha-1
           chain) (Alpha-1- globin).
          Length = 142

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 98/142 (69%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  W             AL+RMF  FPTTKTYF H D+S GSAQVKAHG
Sbjct: 1   MVLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK      L TLA H P DFTP
Sbjct: 61  KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKVSPGAGLSTLAVHLPNDFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFL++VSTVLTSKYR
Sbjct: 121 AVHASLDKFLSTVSTVLTSKYR 142


Go to top
>tr|A4ZQI1|A4ZQI1_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTAWSKIGGHRAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLQVTLARHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQH0|A4ZQH0_PERMA Hemoglobin alpha subunit 1 (Alpha globin).
          Length = 141

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLQVTLARHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1715185A|hemoglobin
          Length = 141

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  W             AL+R F  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSADKANIKATWDKIGGHGGEYGAEALERTFLCFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALAVAAAHLDDLPAALSALSDLHAYKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>sp|P23019|HBA_PROCR Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 101/141 (71%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DK NIK  W             AL+R F  FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSSADKANIKATWDKIGGHGGEYGAEALERTFLCFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLP ALS LSDLHA+KLRVDPVNFK LSHCLLVTLA HHP +FTPA
Sbjct: 61  KVADALAVAAAHLDDLPAALSALSDLHAYKLRVDPVNFKLLSHCLLVTLAAHHPAEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL+SVSTVLTSKYR
Sbjct: 121 VHASLDKFLSSVSTVLTSKYR 141


Go to top
>tr|A4ZQM0|A4ZQM0_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+   W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVNTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASL+KFLASVSTVLTSKYR
Sbjct: 120 AVHASLNKFLASVSTVLTSKYR 141


Go to top
>prf|732180B|hemoglobin alpha3
          Length = 141

 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSA+VK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAZVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+P ALS LSBLHAHKLRVBPV+FK L+HCLLVTLA   P +FTPA
Sbjct: 61  KVAKALTBAVZHLDDMPNALSALSBLHAHKLRVBPVBFKLLNHCLLVTLAABFPSZFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+DKFLASVSTVLTSKYR
Sbjct: 121 VHASVDKFLASVSTVLTSKYR 141


Go to top
>sp|P01934|HBA3_GORGO Hemoglobin subunit alpha-3 (Hemoglobin alpha-2
           chain) (Alpha-3- globin).
          Length = 141

 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H D+S GSA+VK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAZVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+P ALS LSBLHAHKLRVBPV+FK L+HCLLVTLA   P +FTPA
Sbjct: 61  KVAKALTBAVZHLDDMPNALSALSBLHAHKLRVBPVBFKLLNHCLLVTLAABFPSZFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+DKFLASVSTVLTSKYR
Sbjct: 121 VHASVDKFLASVSTVLTSKYR 141


Go to top
>tr|A4ZQJ1|A4ZQJ1_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHGAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHC LVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCPLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1708178A|hemoglobin alpha1
          Length = 139

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+ DKTNIK  W             AL+RMF +FPTTKTYF H D+S GS Q+ AHG 
Sbjct: 1   VLSSADKTNIKTAWGAIGSHAADHGAEALERMFLSFPTTKTYFPHFDMSHGSGQI-AHGK 59

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++D+PGALS LSDLHAHKLRVDPVNFK LSH LLVTLA HHP +FTPA
Sbjct: 60  KVADALTNAVGHIDDMPGALSALSDLHAHKLRVDPVNFKLLSH-LLVTLASHHPAEFTPA 118

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKF A+VSTVLTSKYR
Sbjct: 119 VHASLDKFFAAVSTVLTSKYR 139


Go to top
>tr|A4ZQL4|A4ZQL4_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RM  + PTTKTYF H DVS GSAQVK   
Sbjct: 1   MVLSAEDKANVKTVWSKIGDHHAEYGAEALGRMLESHPTTKTYFPHFDVSHGSAQVKTQD 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|0910195A|hemoglobin alpha
          Length = 142

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D++ GSAQVKAHG 
Sbjct: 1   VLSAADKNNVKGAWEKVGTHAGEYGAEALERMFLSFPTTKTYFPHFDLTHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHP-GDFTP 120
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P  +FTP
Sbjct: 61  KVGAALTKAVGHLDDLPNALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLSRHLPEQEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSNVSTVLTSKYR 142


Go to top
>sp|P01957|HBA_PROHA Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D++ GSAQVKAHG 
Sbjct: 1   VLSAADKNNVKGAWEKVGTHAGEYGAEALERMFLSFPTTKTYFPHFDLTHGSAQVKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHP-GDFTP 120
                      H++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTL+ H P  +FTP
Sbjct: 61  KVGAALTKAVGHLDDLPNALSDLSDLHAHKLRVDPVNFKLLSHCLLVTLSRHLPEQEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKF ++VSTVLTSKYR
Sbjct: 121 AVHASLDKFFSNVSTVLTSKYR 142


Go to top
>tr|A4ZQH2|A4ZQH2_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  172 bits (437), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 99/141 (70%), Gaps = 1/141 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MV+SA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVVSAEDKANVKTVWSKIGDHHAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKY 141
           A+HASLDKFLASVSTVLTSKY
Sbjct: 120 AVHASLDKFLASVSTVLTSKY 140


Go to top
>prf|1306390B|globin alpha1
          Length = 142

 Score =  172 bits (437), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 98/142 (69%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLS DDK ++K  W             AL+RMF +FPTTKTYF H D+S GS QV  HG
Sbjct: 1   MVLSPDDKKHVKAAWGKVGEHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSDQVNKHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       HV+D+P ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  KKVADALTLAVGHVDDMPQALSKLSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A  ASLDKFLASVSTVLTSKYR
Sbjct: 121 AHVASLDKFLASVSTVLTSKYR 142


Go to top
>prf|3114362B|globin
          Length = 142

 Score =  172 bits (437), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  DK N+K  W             AL+R F++FP+TKTYF+H+++S GSAQV+AHG
Sbjct: 1   MALSDADKNNVKEFWEKLGENTGVYGTEALERTFSSFPSTKTYFAHLELSRGSAQVRAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP A S+LSDLHAHKL+VDP+NFK+LSHC LVTLA HHPG+  P
Sbjct: 61  KKVADALTLAVNHMDDLPAAFSSLSDLHAHKLKVDPINFKYLSHCFLVTLARHHPGNLNP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFL+ VS+VLTSKYR
Sbjct: 121 EVHASLDKFLSIVSSVLTSKYR 142


Go to top
>tr|Q6H1L9|Q6H1L9_MACEU Theta globin.
          Length = 142

 Score =  172 bits (437), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  DK N+K  W             AL+R F++FP+TKTYF+H+++S GSAQV+AHG
Sbjct: 1   MALSDADKNNVKEFWEKLGENTGVYGTEALERTFSSFPSTKTYFAHLELSRGSAQVRAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLP A S+LSDLHAHKL+VDP+NFK+LSHC LVTLA HHPG+  P
Sbjct: 61  KKVADALTLAVNHMDDLPAAFSSLSDLHAHKLKVDPINFKYLSHCFLVTLARHHPGNLNP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFL+ VS+VLTSKYR
Sbjct: 121 EVHASLDKFLSIVSSVLTSKYR 142


Go to top
>tr|A4ZQI0|A4ZQI0_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  172 bits (435), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 98/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RM  + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMLESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLQVTLARHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>prf|1814300B|globin
          Length = 142

 Score =  172 bits (435), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  W             AL+RMF +FPTTKTYF H D+S GSAQVK HG 
Sbjct: 1   VLSAADKGNVKAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGA 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHAHKLRVDPVNFK LSH LLVTLA H P D TPA
Sbjct: 61  KVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDCTPA 120

Query: 122 MH-ASLDKFLASVSTVLTSKYR 142
           +H ASLDKF A+VSTVLTSKYR
Sbjct: 121 VHAASLDKFFANVSTVLTSKYR 142


Go to top
>tr|A4ZQJ8|A4ZQJ8_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  172 bits (435), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 98/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSADDK N+K  W             AL RMF + PTTKTYF H DVS  SAQVK  G
Sbjct: 1   MVLSADDKANVKTVWNKIGGHHAEYGAEALGRMFESHPTTKTYFPHFDVSHSSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDL AHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  SKVADALATAADNLDDLPGALSALSDLPAHKLRVDPVNFKLLSHCLLVTLAAHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFLASVSTVLTSKYR
Sbjct: 120 VVHASLDKFLASVSTVLTSKYR 141


Go to top
>sp|P15162|HBA_APUAP Hemoglobin subunit alpha-A (Hemoglobin alpha-A
           chain) (Alpha-A- globin).
          Length = 142

 Score =  171 bits (434), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 97/142 (68%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DKTN+K  +             AL RMFAA+P TKTYF H D+SPGSAQVKAHG
Sbjct: 1   MVLSAADKTNVKGVFAKIGGQAEALGGEALARMFAAYPPTKTYFPHFDLSPGSAQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++D+ GALS LSDLHA KLRVDPVNFK L HC LV +A HHP   TP
Sbjct: 61  KKVASALVEAANNIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAIHHPSVLTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFL +V+TVLT+KYR
Sbjct: 121 EVHASLDKFLCAVATVLTAKYR 142


Go to top
>prf|732180A|hemoglobin alpha3
          Length = 141

 Score =  171 bits (433), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS  DKTN+K  W             AL+RMF +FPTTKTYF H B+S GSA+VK HG 
Sbjct: 1   VLSPADKTNVKAAWGKVGAHAGZYGAZALZRMFLSFPTTKTYFPHFBLSHGSAZVKGHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++B+P ALS LSBLHAHKLRVBPV+FK L+HCLLVTLA   P +FTPA
Sbjct: 61  KVAKALSBAVZHLBBMPBALSALSBLHAHKLRVBPVBFKLLNHCLLVTLAABFPSEFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HAS+BKFLASVSTVLTSKYR
Sbjct: 121 VHASVBKFLASVSTVLTSKYR 141


Go to top
>tr|B2BSP2|B2BSP2_PERMA Hemoglobin alpha chain.
          Length = 142

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 96/142 (67%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL R      TTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHHAEYGAEALGRDVRKPLTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPGALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P DFT 
Sbjct: 61  AKVADALATAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPSDFTS 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 121 AVHASLDKFLASVSTVLTSKYR 142


Go to top
>prf|3114362A|globin
          Length = 142

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/142 (60%), Positives = 97/142 (68%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK ++K  W              L+R F +FPTTKTYF H D+S GSAQ++AHG
Sbjct: 1   MVLSAADKGHVKGIWGKVGGHAGEYAAEGLERTFHSFPTTKTYFPHFDLSHGSAQIQAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSHCLLVT A H    FTP
Sbjct: 61  KKIADALGQAVEHIDDLPGTLSKLSDLHAHKLRVDPVNFKLLSHCLLVTFAAHLGDAFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 EVHASLDKFLAAVSTVLTSKYR 142


Go to top
>sp|P81043|HBA_MACEU Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 142

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/142 (60%), Positives = 97/142 (68%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK ++K  W              L+R F +FPTTKTYF H D+S GSAQ++AHG
Sbjct: 1   MVLSAADKGHVKGIWGKVGGHAGEYAAEGLERTFHSFPTTKTYFPHFDLSHGSAQIQAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG LS LSDLHAHKLRVDPVNFK LSHCLLVT A H    FTP
Sbjct: 61  KKIADALGQAVEHIDDLPGTLSKLSDLHAHKLRVDPVNFKLLSHCLLVTFAAHLGDAFTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HASLDKFLA+VSTVLTSKYR
Sbjct: 121 EVHASLDKFLAAVSTVLTSKYR 142


Go to top
>tr|A4ZQL8|A4ZQL8_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 98/142 (69%), Gaps = 1/142 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RM  + PTTKTYF H DVS GSAQVK   
Sbjct: 1   MVLSAEDKANVKTVWSKIGDHHAEYGAEALGRMLESHPTTKTYFPHFDVSHGSAQVKTQD 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCLLVTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLTSKYR
Sbjct: 120 AVHASLDKFLASVSTVLTSKYR 141


Go to top
>pdb|1HDS_C|1.98| 4| 141|N|HEMOGLOBIN (SICKLE CELL)                 
                       
          Length = 141

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/141 (60%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA +K+N+K  W             ALQRMF +FPTTKTYF H D+S GSAQ KAHG 
Sbjct: 1   VLSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLSFPTTKTYFPHFDLSHGSAQQKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLPG LS LS+LHAHKLRV+PVNFK LSH LLVTLA H P +FTPA
Sbjct: 61  KVANALTKAQGHLNDLPGTLSNLSNLHAHKLRVNPVNFKLLSHSLLVTLASHLPTNFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HA+L+KFLA+ STVLTSKYR
Sbjct: 121 VHANLNKFLANDSTVLTSKYR 141


Go to top
>pdb|1HDS_A|1.98| 4| 141|N|HEMOGLOBIN (SICKLE CELL)                 
                       
          Length = 141

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/141 (60%), Positives = 99/141 (70%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA +K+N+K  W             ALQRMF +FPTTKTYF H D+S GSAQ KAHG 
Sbjct: 1   VLSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLSFPTTKTYFPHFDLSHGSAQQKAHGQ 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H+ DLPG LS LS+LHAHKLRV+PVNFK LSH LLVTLA H P +FTPA
Sbjct: 61  KVANALTKAQGHLNDLPGTLSNLSNLHAHKLRVNPVNFKLLSHSLLVTLASHLPTNFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HA+L+KFLA+ STVLTSKYR
Sbjct: 121 VHANLNKFLANDSTVLTSKYR 141


Go to top
>tr|A4ZQH3|A4ZQH3_PERMA Hemoglobin alpha subunit 1.
          Length = 141

 Score =  170 bits (430), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 97/141 (68%), Gaps = 1/141 (0%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTY  H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYLPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLP ALS LSDLHAHKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPAALSALSDLHAHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKY 141
           A+HASLDKFLASVSTVLTSKY
Sbjct: 120 AVHASLDKFLASVSTVLTSKY 140


Go to top
>sp|P01985|HBA_ANSSE Hemoglobin subunit alpha-A (Hemoglobin alpha-A
           chain) (Alpha-A- globin).
          Length = 142

 Score =  170 bits (430), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/142 (57%), Positives = 94/142 (66%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA DK N+K  +              LQRMF  FP TKTYF H D+ PGSAQ+KAHG
Sbjct: 1   MVLSAADKGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQPGSAQIKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++D+ GALS LSDLHA KLRVDPVNFKFL HC LV LA HHP   TP
Sbjct: 61  KKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            +HAS+DKFL +V+TVLT+KYR
Sbjct: 121 EVHASMDKFLCAVATVLTAKYR 142


Go to top
>tr|A4ZQ59|A4ZQ59_PERMA Hemoglobin subunit theta (Theta globin).
          Length = 142

 Score =  170 bits (430), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 98/142 (69%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  D+  +   W             AL+R F AFP+TKTYF H+D+SPGS+QVKAHG
Sbjct: 1   MALSQSDRALVLALWKKMSSNVGIYATEALERTFVAFPSTKTYFPHMDLSPGSSQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG+LS LSDLHAHKLRV+P NF+F +HCLLVTLA H+PGDF+P
Sbjct: 61  QKVADALTLAAHHLDDLPGSLSALSDLHAHKLRVEPANFQFFNHCLLVTLARHYPGDFSP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            MHASLDKFL  V++VL SKYR
Sbjct: 121 KMHASLDKFLGLVTSVLVSKYR 142


Go to top
>prf|0709222C|hemoglobin alpha
          Length = 141

 Score =  169 bits (429), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 97/141 (68%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+DDK N+K  W             AL+RMF A+P TK YF H D+S GSAQ++AHG 
Sbjct: 1   VLSSDDKCNVKAVWSKVAGHLEEYGAEALERMFCAYPQTKIYFPHFDLSHGSAQIRAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGAL  LS+LHAH LRVDPVNFKFL+ C+LV +A HHPG  TP 
Sbjct: 61  KVFAALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFKFLAQCVLVVVAIHHPGSLTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL +VS+VLTSKYR
Sbjct: 121 VHASLDKFLCAVSSVLTSKYR 141


Go to top
>sp|P01998|HBA_CRONI Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  169 bits (429), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 97/141 (68%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLS+DDK N+K  W             AL+RMF A+P TK YF H D+S GSAQ++AHG 
Sbjct: 1   VLSSDDKCNVKAVWSKVAGHLEEYGAEALERMFCAYPQTKIYFPHFDLSHGSAQIRAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGAL  LS+LHAH LRVDPVNFKFL+ C+LV +A HHPG  TP 
Sbjct: 61  KVFAALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFKFLAQCVLVVVAIHHPGSLTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL +VS+VLTSKYR
Sbjct: 121 VHASLDKFLCAVSSVLTSKYR 141


Go to top
>tr|A4ZQI5|A4ZQI5_PERMA Hemoglobin alpha subunit 1.
          Length = 140

 Score =  169 bits (429), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 98/142 (69%), Gaps = 2/142 (1%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           MVLSA+DK N+K  W             AL RMF + PTTKTYF H DVS GSAQVK  G
Sbjct: 1   MVLSAEDKANVKTVWSKIGGHRAEYGAEALGRMFESHPTTKTYFPHFDVSHGSAQVKTQG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       +++DLPGALS LSDLH HKLRVDPVNFK LSHCL VTLA H P +FTP
Sbjct: 61  AKVADALATAADNLDDLPGALSALSDLHTHKLRVDPVNFKLLSHCLQVTLASHQP-EFTP 119

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
           A+HASLDKFLASVSTVLT KYR
Sbjct: 120 AVHASLDKFLASVSTVLT-KYR 140


Go to top
>prf|1601314A|hemoglobin alphaA
          Length = 141

 Score =  169 bits (429), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 96/141 (68%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DKTN+K  +             AL RMFAA+P TKTYF H D+SPGSAQVKAHG 
Sbjct: 1   VLSAADKTNVKGVFAKIGGQAEALGGEALARMFAAYPPTKTYFPHFDLSPGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      +++D+ GALS LSDLHA KLRVDPVNFK L HC LV +A HHP   TP 
Sbjct: 61  KVASALVEAANNIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAIHHPSVLTPE 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFL +V+TVLT+KYR
Sbjct: 121 VHASLDKFLCAVATVLTAKYR 141


Go to top
>prf|1403265A|hemoglobin alpha
          Length = 141

 Score =  169 bits (428), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 98/141 (69%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  +             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKANVKAAFDKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK  S+ LLVTLA H    FTPA
Sbjct: 61  KVGDALVNAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLASNVLLVTLAVHVAAGFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>sp|P11751|HBA_MEGLY Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score =  169 bits (428), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 98/141 (69%)

Query: 2   VLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHGX 61
           VLSA DK N+K  +             AL+RMF +FPTTKTYF H D+S GSAQVKAHG 
Sbjct: 1   VLSAADKANVKAAFDKVGGQAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKAHGK 60

Query: 62  XXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTPA 121
                      H++DLPGALS LSDLHA+KLRVDPVNFK  S+ LLVTLA H    FTPA
Sbjct: 61  KVGDALVNAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLASNVLLVTLAVHVAAGFTPA 120

Query: 122 MHASLDKFLASVSTVLTSKYR 142
           +HASLDKFLASV TVLTSKYR
Sbjct: 121 VHASLDKFLASVGTVLTSKYR 141


Go to top
>tr|A4ZQ74|A4ZQ74_PERMA Hemoglobin subunit theta.
          Length = 142

 Score =  169 bits (428), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 98/142 (69%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  D+  + + W             AL+R F AFP+TKTYF H+D+SPGS+QVKAHG
Sbjct: 1   MALSQSDRALVLSLWKKMSSNVGIYATEALERTFVAFPSTKTYFPHMDLSPGSSQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG+LS LSDLHAHKLRV+P NF+F +HCLLVTLA H+PGDF+P
Sbjct: 61  QKVADALTLAAHHLDDLPGSLSALSDLHAHKLRVEPANFQFFNHCLLVTLARHYPGDFSP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            MHASLDKFL  V++ L SKYR
Sbjct: 121 KMHASLDKFLGLVTSALVSKYR 142


Go to top
>tr|A4ZQ86|A4ZQ86_PERLE Hemoglobin subunit theta.
          Length = 142

 Score =  168 bits (426), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 97/142 (68%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  D+  +   W             AL+R F AFP+TKTYF H+D+SPGS+QVKAHG
Sbjct: 1   MALSQSDRALVLALWKKMSSNVGIYATEALERTFVAFPSTKTYFPHMDLSPGSSQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG+LS LSDLHAHKLRV+P NF+F +HCLLVTLA H+PGDF+P
Sbjct: 61  QKVADALTLAAHHLDDLPGSLSALSDLHAHKLRVEPANFQFFNHCLLVTLARHYPGDFSP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            MHASLDKFL  V++ L SKYR
Sbjct: 121 KMHASLDKFLGLVTSALVSKYR 142


Go to top
>tr|A4ZQ34|A4ZQ34_PERMA Hemoglobin subunit theta (Hemoglobin theta
           chain).
          Length = 142

 Score =  168 bits (426), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 97/142 (68%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  D+  +   W             AL+R F AFP+TKTYF H+D+SPGS+QVKAHG
Sbjct: 1   MALSQSDRALVLALWKKMSSNVGIYATEALERTFVAFPSTKTYFPHMDLSPGSSQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG+LS LSDLHAHKLRV+P NF+F +HCLLVTLA H+PGDF+P
Sbjct: 61  QKVADALTLAAHHLDDLPGSLSALSDLHAHKLRVEPANFQFFNHCLLVTLARHYPGDFSP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            MHASLDKFL  V++ L SKYR
Sbjct: 121 KMHASLDKFLGLVTSALVSKYR 142


Go to top
>tr|A4ZQ81|A4ZQ81_PERMA Hemoglobin subunit theta.
          Length = 142

 Score =  168 bits (426), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (67%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG 60
           M LS  D+  +   W             AL+R F AFP+TKTYF H+D+SPGS QVKAHG
Sbjct: 1   MALSQSDRALVLALWKKMSSNVGIYATEALERTFVAFPSTKTYFPHMDLSPGSGQVKAHG 60

Query: 61  XXXXXXXXXXXXHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP 120
                       H++DLPG+LS LSDLHAHKLRV+P NF+F +HCLLVTLA H+PGDF+P
Sbjct: 61  QKVADALTLAAHHLDDLPGSLSALSDLHAHKLRVEPANFQFFNHCLLVTLARHYPGDFSP 120

Query: 121 AMHASLDKFLASVSTVLTSKYR 142
            MHASLDKFL  V++ L SKYR
Sbjct: 121 KMHASLDKFLGLVTSALVSKYR 142


Go to top
>sp|P01989|HBA_ANSAN Hemoglobin subunit alpha-A (Hemoglobin alpha-A
           chain) (Alpha-A- globin).
          Length = 142

 Score =  168 bits (425), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 94/142 (66%)

Query: 1   MVLSADDKTNIKNCWXXXXXXXXXXXXXAL