受付番号は、【20080705154323_1646】です。


[CLUSTALW SETUP (Graphical View(<= 100 sequences) | Text View(any number of sequences))]
BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= query
         (105 letters)

Database: PROTEIN: UniProt/Swiss-Prot + TREMBL + PDBSH + PRF protein
sequence database [Last update Jul/05/2008] 
           7,347,543 sequences; 2,386,632,819 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

prf|1103314A|cytochrome c                                              216  5e-55
tr|Q56A15|Q56A15_MOUSE Cytochrome c, somatic (Adult male kidney ...    216  5e-55
sp|P62898|CYC_RAT Cytochrome c, somatic.                               216  5e-55
sp|P62897|CYC_MOUSE Cytochrome c, somatic.                             216  5e-55
prf|0707246A|cytochrome c                                              216  6e-55
prf|770880A|cytochrome c                                               213  3e-54
sp|P68098|CYC_LAMGU Cytochrome c.                                      213  5e-54
sp|P68100|CYC_ESCGI Cytochrome c.                                      213  5e-54
sp|P68099|CYC_CAMDR Cytochrome c.                                      213  5e-54
prf|3111412G|mitochondrial cytochrome c somatic                        212  6e-54
sp|Q52V09|CYC_TARBA Cytochrome c.                                      212  6e-54
sp|P00008|CYC_RABIT Cytochrome c.                                      212  8e-54
prf|1407207B|testis specific cytochrome c                              211  1e-53
sp|P00007|CYC_HIPAM Cytochrome c.                                      210  3e-53
prf|770041A|cytochrome c                                               210  3e-53
prf|721933A|cytochrome c                                               210  3e-53
prf|660863A|cytochrome c                                               210  3e-53
sp|P62896|CYC_SHEEP Cytochrome c.                                      209  4e-53
sp|P62895|CYC_PIG Cytochrome c.                                        209  4e-53
sp|P62894|CYC_BOVIN Cytochrome c.                                      209  4e-53
prf|660913A|cytochrome c                                               209  4e-53
tr|Q3LUG9|Q3LUG9_CAPHI Mitochondrial cytochrome c (Fragment).          209  4e-53
sp|P00011|CYC_CANFA Cytochrome c.                                      207  1e-52
prf|650773A|cytochrome c                                               207  2e-52
pdb|2B4Z_A|1.50| 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    207  2e-52
tr|Q3LUG8|Q3LUG8_BUBBU Mitochondrial cytochrome c (Fragment).          207  2e-52
sp|P00014|CYC_MACGI Cytochrome c.                                      207  3e-52
sp|P00021|CYC_COLLI Cytochrome c.                                      205  7e-52
sp|P00013|CYC_MINSC Cytochrome c.                                      205  7e-52
sp|P00020|CYC_ANAPL Cytochrome c.                                      205  7e-52
sp|P68096|CYC_EQUBU Cytochrome c.                                      205  9e-52
sp|P68097|CYC_EQUAS Cytochrome c.                                      205  9e-52
prf|650776A|cytochrome c                                               205  9e-52
sp|P00012|CYC_MIRLE Cytochrome c.                                      205  9e-52
prf|3111412F|mitochondrial cytochrome c somatic                        205  1e-51
sp|Q52V10|CYC_SAISC Cytochrome c.                                      205  1e-51
sp|P00017|CYC_APTPA Cytochrome c.                                      204  1e-51
prf|660849A|cytochrome c                                               204  2e-51
prf|1002274A|cytochrome c                                              204  2e-51
sp|P67882|CYC_MELGA Cytochrome c.                                      204  2e-51
sp|P67881|CYC_CHICK Cytochrome c.                                      204  2e-51
sp|P00004|CYC_HORSE Cytochrome c.                                      204  2e-51
prf|721949A|cytochrome c                                               203  4e-51
sp|P00018|CYC_DRONO Cytochrome c.                                      202  4e-51
prf|772106A|cytochrome c                                               202  5e-51
sp|P00019|CYC_STRCA Cytochrome c.                                      202  6e-51
prf|660859A|cytochrome c                                               201  1e-50
prf|711086A|cytochrome c                                               201  1e-50
prf|3111412H|mitochondrial cytochrome c somatic                        201  1e-50
sp|Q52V08|CYC_MACSY Cytochrome c.                                      201  1e-50
sp|P00002|CYC_MACMU Cytochrome c.                                      201  1e-50
prf|610169A|cytochrome c                                               201  1e-50
pdb|2PCB_B|2.8 | 3| 104|N|YEAST CYTOCHROME C PEROXIDASE (CCP) CO...    201  1e-50
pdb|2GIW  |NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|2FRC  |NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1WEJ_F|1.8 | 3| 104|N|MOL_ID: 1; MOLECULE: E8 ANTIBODY; CHAI...    201  1e-50
pdb|1U75_B|2.55| 3| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    201  1e-50
pdb|1OCD  |NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1M60_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: ZINC-SUBSTITUTED ...    201  1e-50
pdb|1LC2_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1LC1_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1I5T_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1HRC  |1.9 | 1| 104|N|CYTOCHROME C                          ...    201  1e-50
pdb|1GIW  |NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1FI9_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1FI7_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1CRC_B|2.08| 2| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1CRC_A|2.08| 2| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
pdb|1AKK  |NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    201  1e-50
prf|721078A|cytochrome c                                               201  1e-50
sp|P81280|CYC_ALLMI Cytochrome c.                                      201  2e-50
prf|731223A|cytochrome c                                               200  2e-50
prf|742503A|cytochrome c                                               200  3e-50
prf|2915403C|cytochrome                                                199  4e-50
prf|2915403B|cytochrome                                                199  4e-50
prf|1502366A|cytochrome c                                              199  4e-50
sp|Q5RFH4|CYC_PONAB Cytochrome c.                                      199  4e-50
sp|P99998|CYC_PANTR Cytochrome c.                                      199  4e-50
sp|P99999|CYC_HUMAN Cytochrome c.                                      199  4e-50
sp|Q6WUX8|CYC_GORGO Cytochrome c.                                      199  4e-50
prf|650775A|cytochrome c                                               199  6e-50
sp|Q6DKE1|CYC2_XENLA Cytochrome c, testis-specific.                    199  6e-50
sp|P00024|CYC_RANCA Cytochrome c.                                      199  7e-50
sp|P00022|CYC_CHESE Cytochrome c.                                      198  8e-50
sp|P00003|CYC_ATESP Cytochrome c.                                      198  1e-49
sp|Q6IQM2|CYC_DANRE Cytochrome c.                                      198  1e-49
sp|Q640U4|CYC1_XENTR Cytochrome c, somatic.                            197  2e-49
prf|630485A|cytochrome c                                               197  2e-49
pdb|1J3S_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    197  2e-49
prf|2915403A|cytochrome                                                197  3e-49
sp|Q7YR71|CYC_TRACR Cytochrome c.                                      197  3e-49
prf|660910A|cytochrome c                                               196  4e-49
sp|Q6PBF4|CYC2_XENTR Cytochrome c, testis-specific.                    196  6e-49
sp|P21665|CYC_VARVA Cytochrome c.                                      194  2e-48
sp|P00026|CYC_CYPCA Cytochrome c iso-1/iso-2.                          194  2e-48
sp|Q6GQE4|CYC1A_XENLA Cytochrome c, somatic A.                         193  4e-48
prf|1910201A|cytochrome c                                              193  4e-48
prf|1011182B|cytochrome c                                              192  8e-48
pdb|2AIU_A|1.60| 1| 105|N|MOL_ID: 1; MOLECULE: CYTOCHROME C, TES...    190  2e-47
tr|A2ARH7|A2ARH7_MOUSE Cytochrome c, testis.                           190  2e-47
sp|P00015|CYC2_MOUSE Cytochrome c, testis-specific.                    190  2e-47
tr|B0XHT8|B0XHT8_CULQU Cytochrome c.                                   190  2e-47
prf|671050A|cytochrome c                                               190  3e-47
tr|A3KEW6|A3KEW6_BRABE Cytochrome c.                                   189  5e-47
prf|1407207A|testis specific cytochrome c                              189  5e-47
sp|P10715|CYC2_RAT Cytochrome c, testis-specific.                      189  5e-47
prf|754926A|cytochrome c,testis specific                               189  6e-47
sp|Q6NTN0|CYC1B_XENLA Cytochrome c, somatic B.                         189  6e-47
sp|P00028|CYC_LAMTR Cytochrome c.                                      189  6e-47
tr|Q1HRI9|Q1HRI9_AEDAE Mitochondrial cytochrome c (Cytochrome c).      189  6e-47
prf|1011182A|cytochrome c                                              188  9e-47
prf|701200A|cytochrome c                                               188  1e-46
tr|Q7PSA9|Q7PSA9_ANOGA AGAP009537-PA.                                  188  1e-46
tr|Q6PBG3|Q6PBG3_MOUSE Cytochrome c, testis.                           188  1e-46
sp|Q4SG99|CYC_TETNG Cytochrome c.                                      187  2e-46
sp|Q3SZT9|CYC2_BOVIN Cytochrome c 2.                                   187  2e-46
sp|P00025|CYC_KATPE Cytochrome c.                                      187  2e-46
sp|P12831|CYC_SARPE Cytochrome c.                                      187  3e-46
prf|1211285B|cytochrome c                                              187  3e-46
prf|731289A|cytochrome c                                               186  3e-46
sp|P00039|CYC_MANSE Cytochrome c.                                      186  4e-46
sp|P00040|CYC_SCHGR Cytochrome c.                                      186  6e-46
prf|751315A|cytochrome c                                               185  7e-46
prf|1211285A|cytochrome c                                              185  7e-46
prf|1105333A|cytochrome c                                              185  7e-46
prf|1103315B|cytochrome c                                              185  7e-46
tr|Q29MT2|Q29MT2_DROPS GA14714-PA (Fragment).                          185  7e-46
sp|P84029|CYC2_DROME Cytochrome c-2 (Cytochrome c-proximal).           185  7e-46
sp|P84030|CYC2_CERCA Cytochrome c-2.                                   185  7e-46
prf|771301A|cytochrome c                                               185  7e-46
sp|P00035|CYC_HAEIR Cytochrome c.                                      185  8e-46
sp|P00027|CYC_SQUSU Cytochrome c.                                      185  9e-46
prf|3209367DR|mitochondrial cytochrome c                               184  1e-45
sp|Q1KKS2|CYCB_FUGRU Cytochrome c-b.                                   184  1e-45
prf|710246A|cytochrome c                                               184  2e-45
pdb|1CYC  |2.3 | 1| 103|N|FERROCYTOCHROME $C                    ...    184  2e-45
sp|Q6QLW4|CYC_PECGU Cytochrome c.                                      184  2e-45
prf|630486A|cytochrome c                                               184  2e-45
pdb|5CYT_R|1.5 | 1| 103|N|CYTOCHROME $C (REDUCED)               ...    184  2e-45
pdb|3CYT_I|1.8 | 2| 103|N|CYTOCHROME $C (OXIDIZED)              ...    184  2e-45
pdb|3CYT_O|1.8 | 2| 103|N|CYTOCHROME $C (OXIDIZED)              ...    184  2e-45
pdb|1LFM_B|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
pdb|1LFM_A|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
pdb|1I55_B|2.00| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
pdb|1I55_A|2.00| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
pdb|1I54_B|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
pdb|1I54_A|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHA...    184  2e-45
sp|P81459|CYC_THUAA Cytochrome c.                                      184  2e-45
sp|P00036|CYC_LUCCU Cytochrome c.                                      183  3e-45
prf|0402215A|cytochrome c                                              183  3e-45
tr|A7RZ03|A7RZ03_NEMVE Predicted protein.                              183  3e-45
prf|1105333B|cytochrome c                                              183  4e-45
sp|P00029|CYC_ASTRU Cytochrome c.                                      182  5e-45
sp|P68519|CYC_CROVV Cytochrome c.                                      182  5e-45
sp|P68518|CYC_CROAT Cytochrome c.                                      182  5e-45
sp|P68517|CYC_CROAD Cytochrome c.                                      182  5e-45
prf|670986A|cytochrome c                                               182  6e-45
prf|650737A|cytochrome c                                               182  6e-45
tr|B0WTG4|B0WTG4_CULQU Cytochrome c-2.                                 182  6e-45
sp|A8MY23|CYCL_HUMAN Putative cytochrome c-like protein ENSP0000...    182  9e-45
tr|A8MV93|A8MV93_HUMAN Uncharacterized protein ENSP00000381989.        181  1e-44
tr|A9NRX3|A9NRX3_PICSI Putative uncharacterized protein.               181  1e-44
prf|1709162A|cytochrome c                                              180  3e-44
prf|763065A|cytochrome c                                               180  3e-44
sp|P00037|CYC_SAMCY Cytochrome c.                                      179  5e-44
prf|660916A|cytochrome c                                               179  6e-44
prf|2614268A|cytochrome c                                              178  9e-44
tr|Q9TVZ0|Q9TVZ0_TIGCA Cytochrome c.                                   178  9e-44
tr|Q1ZZQ7|Q1ZZQ7_ACYPI Cytochrome c-like protein.                      178  1e-43
prf|701207A|cytochrome c                                               178  1e-43
tr|Q4PM75|Q4PM75_IXOSC Cytochrome c.                                   177  2e-43
tr|Q9TVZ1|Q9TVZ1_TIGCA Cytochrome c.                                   177  2e-43
tr|Q6B868|Q6B868_9ACAR Cytochrome c.                                   177  3e-43
tr|Q9TZP3|Q9TZP3_TIGCA Cytochrome c.                                   177  3e-43
tr|O96573|O96573_TIGCA Cytochrome c.                                   176  4e-43
sp|P00031|CYC_MACMA Cytochrome c.                                      176  5e-43
tr|O96572|O96572_TIGCA Cytochrome c.                                   175  8e-43
sp|P00038|CYC_APIME Cytochrome c.                                      175  1e-42
prf|1103243A|cytochrome c                                              174  1e-42
tr|Q9TVR1|Q9TVR1_TIGCA Cytochrome c (Fragment).                        174  1e-42
tr|Q4JIM6|Q4JIM6_DERVA Cytochrome C.                                   174  2e-42
prf|765949A|cytochrome c                                               173  3e-42
prf|760259A|cytochrome c                                               173  3e-42
sp|P00030|CYC_EISFO Cytochrome c.                                      173  3e-42
tr|Q9TVT6|Q9TVT6_TIGCA Cytochrome c (Fragment).                        173  4e-42
tr|Q9TVR0|Q9TVR0_TIGCA Cytochrome c (Fragment).                        173  4e-42
tr|Q9TZP2|Q9TZP2_TIGCA Cytochrome c (Fragment).                        172  8e-42
tr|Q1W296|Q1W296_9HEMI Cytochrome c-like protein.                      171  1e-41
tr|Q86EU4|Q86EU4_SCHJA SJCHGC06082 protein.                            171  2e-41
tr|A9V8A8|A9V8A8_MONBE Predicted protein.                              171  2e-41
tr|Q9TZP1|Q9TZP1_TIGCA Cytochrome c (Fragment).                        170  2e-41
tr|Q9TZP4|Q9TZP4_TIGCA Cytochrome c (Fragment).                        169  6e-41
tr|A7RP70|A7RP70_NEMVE Predicted protein.                              166  5e-40
prf|720617A|cytochrome c                                               165  8e-40
sp|P00032|CYC_HELAS Cytochrome c.                                      165  8e-40
tr|Q15EU2|Q15EU2_SCHMA Cytochrome c-like protein.                      165  1e-39
prf|3209367W|mitochondrial cytochrome c                                164  2e-39
sp|Q1KL06|CYCA_FUGRU Cytochrome c-a.                                   164  2e-39
tr|Q29MT1|Q29MT1_DROPS GA12159-PA (Fragment).                          160  4e-38
sp|P00046|CYC_SCHPO Cytochrome c.                                      160  4e-38
prf|0409285A|cytochrome c                                              159  4e-38
prf|710865A|cytochrome c                                               159  5e-38
sp|P00072|CYC_FAGES Cytochrome c.                                      159  5e-38
tr|A9NKS1|A9NKS1_PICSI Putative uncharacterized protein.               159  7e-38
tr|A9P208|A9P208_PICSI Putative uncharacterized protein.               159  7e-38
prf|710737A|cytochrome c                                               156  5e-37
sp|P00074|CYC_GINBI Cytochrome c.                                      156  5e-37
prf|1513365A|cytochrome c                                              156  5e-37
sp|P56205|CYC_ASPNG Cytochrome c.                                      156  5e-37
sp|P00047|CYC_THELA Cytochrome c.                                      155  9e-37
sp|P00057|CYC_RICCO Cytochrome c.                                      154  2e-36
prf|710336A|cytochrome c                                               154  2e-36
tr|A2QC04|A2QC04_ASPNG Cytochrome c cyc-Aspergillus niger.             154  3e-36
sp|P00061|CYC_SOLTU Cytochrome c.                                      153  3e-36
prf|1509323A|cytochrome c                                              153  4e-36
tr|A8J5T0|A8J5T0_CHLRE Mitochondrial cytochrome c.                     153  4e-36
sp|P15451|CYC_CHLRE Cytochrome c.                                      153  4e-36
tr|A1DHL6|A1DHL6_NEOFI Cytochrome c.                                   152  5e-36
sp|P38091|CYC_EMENI Cytochrome c.                                      152  6e-36
tr|A2I3V8|A2I3V8_MACHI Cytochrome c-like protein.                      152  6e-36
prf|710336B|cytochrome c                                               152  6e-36
sp|P00054|CYC_SESIN Cytochrome c.                                      152  6e-36
sp|O22642|CYC_FRIAG Cytochrome c.                                      152  6e-36
sp|P00060|CYC_SOLLC Cytochrome c.                                      152  8e-36
prf|741472A|cytochrome c                                               152  9e-36
prf|1103315A|cytochrome c                                              152  9e-36
sp|P04657|CYC1_DROME Cytochrome c-1 (Cytochrome c-distal).             152  9e-36
prf|2010393A|cytochrome c                                              152  9e-36
tr|A6RAF0|A6RAF0_AJECN Cytochrome c.                                   152  9e-36
tr|B0D4B4|B0D4B4_LACBS Cytochrome c C1.                                152  1e-35
prf|670964A|cytochrome c                                               152  1e-35
sp|P00068|CYC_WHEAT Cytochrome c.                                      152  1e-35
tr|A4RW27|A4RW27_OSTLU Predicted protein.                              152  1e-35
tr|Q9ZSL2|Q9ZSL2_CICIN Cytochrome (Fragment).                          151  1e-35
prf|720331A|cytochrome c                                               151  2e-35
prf|754757A|cytochrome c                                               150  2e-35
sp|P00069|CYC_GUIAB Cytochrome c.                                      150  2e-35
tr|Q4X0L0|Q4X0L0_ASPFU Cytochrome c.                                   150  2e-35
tr|B0XTA5|B0XTA5_ASPFC Cytochrome c.                                   150  2e-35
sp|Q4HVX7|CYC_GIBZE Cytochrome c.                                      150  2e-35
prf|730271A|cytochrome c                                               150  3e-35
sp|P00058|CYC_GOSBA Cytochrome c.                                      150  3e-35
sp|P00064|CYC_ALLPO Cytochrome c.                                      150  3e-35
tr|Q1WLY6|Q1WLY6_CHLIN Mitochondrial apocytochrome c.                  150  3e-35
tr|Q1DX67|Q1DX67_COCIM Cytochrome c.                                   150  3e-35
tr|A3AYZ5|A3AYZ5_ORYSJ Putative uncharacterized protein.               150  3e-35
sp|P25400|CYC_CANGA Cytochrome c.                                      150  3e-35
sp|P00059|CYC_ABUTH Cytochrome c.                                      150  4e-35
tr|A9PJI0|A9PJI0_POPJC Putative uncharacterized protein.               149  5e-35
tr|A8QAI4|A8QAI4_MALGO Putative uncharacterized protein.               149  5e-35
prf|710866B|cytochrome c                                               149  7e-35
prf|700887A|cytochrome c                                               149  7e-35
prf|710866A|cytochrome c                                               149  8e-35
tr|Q0CYF4|Q0CYF4_ASPTN Cytochrome c.                                   149  8e-35
tr|Q9UVX5|Q9UVX5_FUSOX Cytochrome c549.                                148  9e-35
sp|P53698|CYC_CANAL Cytochrome c.                                      148  1e-34
prf|710865B|cytochrome c                                               148  1e-34
sp|P00056|CYC_MAIZE Cytochrome c.                                      148  1e-34
sp|P19681|CYC_DEBOC Cytochrome c.                                      148  1e-34
prf|730272A|cytochrome c                                               148  1e-34
sp|P00073|CYC_SPIOL Cytochrome c.                                      148  1e-34
tr|Q2GVW3|Q2GVW3_CHAGB Cytochrome c.                                   148  1e-34
prf|3201383KTH|ORF                                                     148  1e-34
tr|Q2UFB7|Q2UFB7_ASPOR Cytochrome c.                                   148  1e-34
tr|A9P8Y7|A9P8Y7_POPTR Putative uncharacterized protein.               148  2e-34
tr|A1C6Y9|A1C6Y9_ASPCL Cytochrome c.                                   147  2e-34
tr|A9SNF0|A9SNF0_PHYPA Predicted protein.                              147  2e-34
prf|2904232A|cytochrome c                                              147  2e-34
sp|P59218|CYC_ROSNE Cytochrome c.                                      147  2e-34
sp|P00070|CYC_HELAN Cytochrome c.                                      147  2e-34
prf|711058A|cytochrome c                                               147  2e-34
sp|P62773|CYC_BRAOL Cytochrome c.                                      147  2e-34
sp|P62772|CYC_BRANA Cytochrome c.                                      147  2e-34
tr|Q5AZN4|Q5AZN4_EMENI Putative uncharacterized protein.               147  3e-34
prf|741670C|cytochrome c                                               147  3e-34
prf|2113246A|cytochrome c                                              147  3e-34
prf|1309219A|cytochrome c                                              147  3e-34
sp|P00067|CYC_TROMA Cytochrome c.                                      147  3e-34
sp|P00048|CYC_NEUCR Cytochrome c.                                      147  3e-34
tr|A7QC93|A7QC93_VITVI Chromosome undetermined scaffold_77, whol...    146  4e-34
prf|741670D|cytochrome c                                               146  4e-34
sp|P00071|CYC_PASSA Cytochrome c.                                      146  4e-34
tr|A2Q5X9|A2Q5X9_MEDTR Cytochrome c, monohaem.                         146  4e-34
prf|730986A|cytochrome c                                               146  4e-34
sp|P00066|CYC_NIGDA Cytochrome c.                                      146  4e-34
prf|741670A|cytochrome c                                               146  4e-34
sp|P00063|CYC_ACENE Cytochrome c.                                      146  4e-34
prf|701219A|cytochrome c                                               146  4e-34
tr|Q0TY36|Q0TY36_PHANO Putative uncharacterized protein.               146  6e-34
sp|Q0DI31|CYC_ORYSJ Cytochrome c.                                      146  6e-34
sp|A2Y4S9|CYC_ORYSI Cytochrome c.                                      146  6e-34
prf|3106401AJC|electron carrier                                        145  6e-34
tr|Q5KNC7|Q5KNC7_CRYNE Electron carrier, putative (Putative unch...    145  6e-34
prf|742520A|cytochrome c                                               145  6e-34
sp|P00075|CYC_ENTIN Cytochrome c.                                      145  6e-34
tr|Q6S4N3|Q6S4N3_HELAN Cytochrome c.                                   145  7e-34
sp|O13393|CYC_PICST Cytochrome c.                                      145  7e-34
tr|A9SRQ9|A9SRQ9_PHYPA Predicted protein.                              145  7e-34
sp|P00043|CYC_DEBHA Cytochrome c.                                      145  8e-34
prf|710864A|cytochrome c                                               145  1e-33
tr|Q8IM53|Q8IM53_PLAF7 Cytochrome c, putative.                         145  1e-33
sp|P00051|CYC_CUCMA Cytochrome c.                                      145  1e-33
sp|P00052|CYC_PHAAU Cytochrome c.                                      145  1e-33
sp|O23138|CYC2_ARATH Probable cytochrome c At1g22840.                  145  1e-33
tr|Q4PB05|Q4PB05_USTMA CYC_USTSP Cytochrome c.                         145  1e-33
tr|A9PHL1|A9PHL1_POPTR Putative uncharacterized protein.               145  1e-33
pdb|2YCC  |1.9 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (OXIDIZED) (...    144  1e-33
pdb|2ORL_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C ISO-...    144  1e-33
pdb|2HV4_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C ISO-...    144  1e-33
pdb|1NMI_A|NOT | 1| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C, ISO...    144  1e-33
sp|Q6Q4H8|CYC_PICPA Cytochrome c.                                      144  1e-33
sp|P00065|CYC_ARUMA Cytochrome c.                                      144  1e-33
prf|1309219B|cytochrome c mutant                                       144  2e-33
pdb|1S6V_D|1.88| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    144  2e-33
pdb|1S6V_B|1.88| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    144  2e-33
pdb|1CSW  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    144  2e-33
pdb|1CCR  |1.5 | 1| 111|N|CYTOCHROME $C                         ...    144  2e-33
tr|Q4XLY1|Q4XLY1_PLACH Cytochrome c, putative.                         144  2e-33
pdb|1CSV  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    144  3e-33
tr|A7PPW4|A7PPW4_VITVI Chromosome chr18 scaffold_24, whole genom...    144  3e-33
tr|A6S6K1|A6S6K1_BOTFB Cytochrome c.                                   144  3e-33
tr|Q7RDJ2|Q7RDJ2_PLAYO Cytochrome c.                                   143  3e-33
pdb|2BCN_B|1.70| 3| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    143  3e-33
pdb|1U74_D|2.40| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    143  3e-33
pdb|1U74_B|2.40| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    143  3e-33
prf|710272A|cytochrome c                                               143  3e-33
tr|A8P386|A8P386_COPC7 Putative uncharacterized protein.               143  3e-33
pdb|1CHH  |1.97| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    143  3e-33
pdb|1CHJ  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    143  3e-33
pdb|1CSU  |1.81| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    143  4e-33
tr|A5K1I5|A5K1I5_PLAVI Cytochrome c, putative.                         143  4e-33
pdb|1CTZ  |1.9 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (REDUCED) MU...    143  4e-33
pdb|1CTY  |2.2 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (OXIDIZED) M...    143  4e-33
tr|A9RJ09|A9RJ09_PHYPA Predicted protein.                              143  5e-33
prf|2115448A|iso-1-cytochrome c                                        142  5e-33
prf|1409323A|CYC1 locus                                                142  5e-33
tr|A6ZQ07|A6ZQ07_YEAS7 Iso-1-cytochrome c.                             142  5e-33
sp|P00044|CYC1_YEAST Cytochrome c iso-1.                               142  5e-33
prf|1715320A|cytochrome c                                              142  6e-33
sp|P00062|CYC_SAMNI Cytochrome c.                                      142  6e-33
sp|P29380|CYC1_ARATH Cytochrome c.                                     142  6e-33
prf|732192A|cytochrome c                                               142  6e-33
sp|P00053|CYC_CANSA Cytochrome c.                                      142  6e-33
pdb|2PCC_D|2.3 | 4| 108|N|YEAST CYTOCHROME C PEROXIDASE (CCP) CO...    142  6e-33
pdb|2PCC_B|2.3 | 4| 108|N|YEAST CYTOCHROME C PEROXIDASE (CCP) CO...    142  6e-33
pdb|2GB8_B|NOT | 2| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    142  6e-33
pdb|1YCC  |1.23| 1| 107|N|CYTOCHROME C (ISOZYME 1) (REDUCED)    ...    142  6e-33
prf|0602215A|cytochrome c                                              142  6e-33
pdb|1CSX  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    142  7e-33
tr|A5AQD0|A5AQD0_VITVI Putative uncharacterized protein.               142  7e-33
tr|Q4YTB6|Q4YTB6_PLABE Cytochrome c, putative.                         142  8e-33
pdb|1CHI  |2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    142  8e-33
prf|741670B|cytochrome c                                               142  8e-33
sp|P00041|CYC_ISSOR Cytochrome c.                                      142  8e-33
sp|Q96VP3|CYC_CURLU Cytochrome c.                                      142  8e-33
pdb|1FHB  |NOT | 1| 108|M|MOL_ID: 1; MOLECULE: FERRICYTOCHROME C...    142  9e-33
prf|2102349A|cytochrome c                                              142  9e-33
sp|Q41346|CYC_STELP Cytochrome c.                                      142  9e-33
prf|0709211A|cytochrome c                                              141  1e-32
sp|P00042|CYC_HANAN Cytochrome c.                                      141  1e-32
pdb|1YEB  |1.95| 1| 108|N|CYTOCHROME C (B-2036 COMPOSITE, REDUCE...    141  1e-32
tr|A7E6R4|A7E6R4_SCLS1 Cytochrome c.                                   141  1e-32
prf|0602232A|cytochrome c iso2                                         141  1e-32
tr|A6ZQR1|A6ZQR1_YEAS7 Iso-2-cytochrome c.                             141  1e-32
sp|P00045|CYC7_YEAST Cytochrome c iso-2.                               141  1e-32
tr|Q4RNP2|Q4RNP2_TETNG Chromosome 2 SCAF15010, whole genome shot...    141  1e-32
sp|Q9T0G2|CYC3_ARATH Probable cytochrome c At4g10040.                  141  1e-32
pdb|1YEA  |1.9 | 1| 112|N|CYTOCHROME C (ISO-2, REDUCED STATE)   ...    141  1e-32
pdb|1LMS_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C, ISO...    141  2e-32
pdb|2B12_B|3.02| 2| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    141  2e-32
pdb|1CRG  |2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (OXIDIZED) MU...    141  2e-32
prf|721942A|cytochrome c iso2                                          141  2e-32
sp|Q4N594|CYC_THEPA Cytochrome c.                                      140  2e-32
prf|681080A|cytochrome c                                               140  2e-32
prf|721941A|cytochrome cA                                              140  2e-32
prf|721254A|cytochrome c                                               140  2e-32
tr|B2B0B7|B2B0B7_PODAN Predicted CDS Pa_3_8590.                        140  2e-32
tr|A5DYC1|A5DYC1_LODEL Cytochrome c.                                   140  2e-32
sp|P00049|CYC_USTSP Cytochrome c.                                      140  2e-32
pdb|2B11_D|2.30| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    140  2e-32
pdb|2B11_B|2.30| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    140  2e-32
tr|A7ANI1|A7ANI1_BABBO Cytochrome c, putative.                         140  3e-32
pdb|2B0Z_B|2.70| 2| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    140  3e-32
tr|A4R2C5|A4R2C5_MAGGR Cytochrome c.                                   140  4e-32
prf|690947A|cytochrome c                                               140  4e-32
pdb|1CRJ  |2.05| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    139  4e-32
pdb|1CRI  |2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (OXIDIZED) MU...    139  4e-32
tr|A7TN23|A7TN23_VANPO Putative uncharacterized protein.               139  5e-32
pdb|2B10_D|2.80| 4| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    139  5e-32
pdb|2B10_B|2.80| 4| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C PERO...    139  5e-32
pdb|1CRH  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    139  7e-32
tr|A5DJV7|A5DJV7_PICGU Cytochrome c.                                   138  1e-31
tr|Q5EMY9|Q5EMY9_MAGGR Cytochrome c-like protein.                      138  1e-31
tr|Q8GU28|Q8GU28_9CHLO Cytochrome c.                                   138  1e-31
tr|A9V8B2|A9V8B2_MONBE Predicted protein.                              138  1e-31
pdb|1RAQ  |1.9 | 1| 108|M|REP A2 ISO-1-CYTOCHROME C (REDUCED STA...    138  2e-31
pdb|1YTC  |1.8 | 1| 112|M|MOL_ID: 1; MOLECULE: YEAST ISO-2 CYTOC...    137  2e-31
pdb|1CIF  |1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    137  3e-31
sp|Q4UEA0|CYC_THEAN Cytochrome c.                                      137  3e-31
sp|O93863|CYC_PACTA Cytochrome c.                                      137  3e-31
prf|2214401B|cytochrome c                                              136  4e-31
prf|3024408ADX|AFR360Wp protein                                        136  4e-31
pdb|1CIG  |1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    136  4e-31
pdb|1CIE  |1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    136  5e-31
prf|1915382A|cytochrome c                                              136  5e-31
sp|P32556|CYC_KLULA Cytochrome c.                                      136  5e-31
pdb|1RAP  |2.25| 1| 108|M|REP A2 ISO-1-CYTOCHROME C (REDUCED STA...    136  6e-31
sp|P92504|CYC1_ASCSU Cytochrome c type-1.                              135  6e-31
sp|P19974|CYC_CAEEL Cytochrome c.                                      135  6e-31
prf|1702154A|cytochrome c                                              135  7e-31
sp|Q753F4|CYC_ASHGO Cytochrome c.                                      135  8e-31
tr|A9SLT5|A9SLT5_PHYPA Predicted protein.                              135  1e-30
tr|A8X769|A8X769_CAEBR CBR-CYC-2.2 protein.                            134  2e-30
pdb|1CIH  |1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUT...    133  4e-30
sp|Q23240|CYC2_CAEEL Probable cytochrome c.                            133  5e-30
tr|A8WQY3|A8WQY3_CAEBR CBR-CYC-2.1 protein.                            132  7e-30
sp|Q6C9Q0|CYC_YARLI Cytochrome c.                                      132  9e-30
prf|660860A|cytochrome c                                               132  9e-30
tr|Q4CV48|Q4CV48_TRYCR Cytochrome c, putative.                         129  8e-29
prf|3110434HRF|cytochrome c                                            128  1e-28
sp|Q869N1|CYC_DICDI Cytochrome c.                                      128  1e-28
prf|3307400C|cytochrome c                                              127  2e-28
tr|A3E3B3|A3E3B3_PFIPI Cytochrome c.                                   127  2e-28
prf|3307400G|cytochrome c                                              127  3e-28
tr|A3E3B7|A3E3B7_PFIPI Cytochrome c.                                   127  3e-28
tr|Q4D480|Q4D480_TRYCR Cytochrome c, putative.                         127  3e-28
prf|3307400J|cytochrome c                                              127  3e-28
prf|3307400H|cytochrome c                                              127  3e-28
prf|3307400F|cytochrome c                                              127  3e-28
prf|3307400E|cytochrome c                                              127  3e-28
prf|3307400D|cytochrome c                                              127  3e-28
tr|A3E3B4|A3E3B4_PFIPI Cytochrome c.                                   127  3e-28
prf|730760A|cytochrome c                                               127  3e-28
sp|P00076|CYC_EUGGR Cytochrome c.                                      127  3e-28
tr|A4H8R0|A4H8R0_LEIBR Cytochrome c, putative.                         125  7e-28
prf|3307400K|cytochrome c                                              125  1e-27
tr|A3E3C0|A3E3C0_PFIPI Cytochrome c.                                   125  1e-27
tr|A8PJQ3|A8PJQ3_BRUMA Cytochrome c type-1, putative.                  125  1e-27
tr|A4HX28|A4HX28_LEIIN Cytochrome c, putative.                         124  2e-27
prf|3114405NDK|cytochrome c                                            124  2e-27
prf|3114405NDJ|cytochrome c                                            124  2e-27
tr|Q4QEN5|Q4QEN5_LEIMA Cytochrome c, putative (Cytochrome c).          124  2e-27
tr|A4H8Q9|A4H8Q9_LEIBR Cytochrome c, putative.                         124  3e-27
tr|A4HX29|A4HX29_LEIIN Cytochrome c, putative.                         123  4e-27
prf|3114407FND|cytochrome c                                            123  4e-27
prf|3114405FND|cytochrome c                                            123  4e-27
tr|Q57UI4|Q57UI4_9TRYP Cytochrome c.                                   123  4e-27
prf|2214401A|cytochrome c                                              122  6e-27
prf|752390A|cytochrome c555                                            122  9e-27
sp|P22342|CYC_EUGVI Cytochrome c.                                      122  1e-26
sp|P00078|CYC_CRIFA Cytochrome c (Cytochrome c555).                    121  1e-26
tr|O22490|O22490_ORYSA Cytochrome C.                                   121  1e-26
sp|P00077|CYC_CRION Cytochrome c (Cytochrome c557).                    121  2e-26
prf|720975A|cytochrome c                                               121  2e-26
prf|1712125C|cytochrome c                                              120  4e-26
sp|P92505|CYC2_ASCSU Cytochrome c type-2.                              120  4e-26
prf|760999B|cytochrome c2                                              119  5e-26
tr|Q8S0R8|Q8S0R8_ORYSJ Putative cytochrome c (Os01g0885000 prote...    118  1e-25
pdb|1IO3_A|1.90| 1| 107|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2; CH...    117  3e-25
pdb|1CRY  |3.0 | 1| 107|N|CYTOCHROME C2                         ...    117  3e-25
pdb|1CO6_A|1.6 | 1| 107|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2; CH...    117  3e-25
tr|A2WXP5|A2WXP5_ORYSI Putative uncharacterized protein.               116  4e-25
tr|A3WHT0|A3WHT0_9SPHN Cytochrome c family protein.                    116  5e-25
prf|1616291A|cytochrome c2                                             115  1e-24
sp|P00083|CYC2_RHOVI Cytochrome c2 precursor.                          115  1e-24
tr|B2IAX0|B2IAX0_9RHIZ Cytochrome c class I precursor.                 112  7e-24
prf|3019327C|cytochrome c precursor                                    112  8e-24
tr|Q64I04|Q64I04_AZOBR Cytochrome c.                                   112  8e-24
prf|3110385DLM|cytochrome c2                                           112  1e-23
tr|Q8FXA6|Q8FXA6_BRUSU Cytochrome c2.                                  112  1e-23
tr|Q579S1|Q579S1_BRUAB CycA, cytochrome c2.                            112  1e-23
tr|Q2YIS2|Q2YIS2_BRUA2 Cytochrome c heme-binding site:Cytochrome...    112  1e-23
tr|A9WXN0|A9WXN0_BRUSI Putative uncharacterized protein.               112  1e-23
tr|A9MDT1|A9MDT1_BRUC2 Cytochrome c2.                                  112  1e-23
tr|A5VTS2|A5VTS2_BRUO2 Cytochrome c heme-binding site:cytochrome...    112  1e-23
tr|A3WRV1|A3WRV1_9BRAD Cytochrome c, class I.                          112  1e-23
tr|Q8YB33|Q8YB33_BRUME CYTOCHROME C2.                                  110  2e-23
sp|P00084|CYC2_RHOAC Cytochrome c2.                                    110  3e-23
prf|3206257MY|cytochrome c                                             110  3e-23
tr|Q3SVY7|Q3SVY7_NITWN Cytochrome c, class I precursor.                110  3e-23
prf|760999A|cytochrome c2                                              109  5e-23
sp|P00082|CYC2_RHOVA Cytochrome c2.                                    109  5e-23
prf|3323271FD|cytochrome c                                             108  2e-22
tr|A8IGU6|A8IGU6_AZOC5 Cytochrome c.                                   108  2e-22
tr|A3UDF9|A3UDF9_9RHOB Cytochrome c family protein.                    107  2e-22
tr|A2Q5Y1|A2Q5Y1_MEDTR Cytochrome c, monohaem.                         107  2e-22
prf|3401267CWU|cytochrome c                                            107  3e-22
tr|Q0BQU4|Q0BQU4_GRABC Cytochrome c.                                   107  3e-22
tr|A7IBX2|A7IBX2_XANP2 Cytochrome c class I precursor.                 107  4e-22
tr|A7HW37|A7HW37_PARL1 Cytochrome c class I precursor.                 107  4e-22
prf|3206257EFQ|cytochrome c                                            106  4e-22
tr|Q3SPF6|Q3SPF6_NITWN Cytochrome c, class I.                          106  4e-22
tr|Q9A8Y7|Q9A8Y7_CAUCR Cytochrome c family protein.                    105  7e-22
tr|A3WT90|A3WT90_9BRAD Cytochrome c, class I.                          105  1e-21
tr|Q1QIK7|Q1QIK7_NITHX Cytochrome c, class I precursor.                105  1e-21
sp|Q45233|CY550_BRAJA Cytochrome c-550 precursor (Cytochrome c550).    105  1e-21
tr|Q2IZ83|Q2IZ83_RHOP2 Cytochrome c, class I precursor.                104  2e-21
tr|Q07K37|Q07K37_RHOP5 Cytochrome c, class I precursor.                104  2e-21
tr|B1WIW5|B1WIW5_OLICA Cytochrome c2.                                  103  3e-21
prf|3101377HEF|cytochrome c family protein                             103  4e-21
tr|Q5LL49|Q5LL49_SILPO Cytochrome c family protein.                    103  4e-21
tr|A3JVA4|A3JVA4_9RHOB Diheme cytochrome c SoxE.                       103  4e-21
tr|A3A0A7|A3A0A7_ORYSJ Putative uncharacterized protein.               103  4e-21
prf|0810182A|cytochrome c550                                           103  5e-21
sp|P00085|CY550_NITWI Cytochrome c-550 (Cytochrome c550).              103  5e-21
tr|A3T0C0|A3T0C0_9RHOB Cytochrome c552.                                102  7e-21
tr|A3SFM9|A3SFM9_9RHOB Cytochrome c552.                                102  8e-21
tr|A5VFF8|A5VFF8_SPHWW Cytochrome c, class I.                          102  8e-21
prf|3311456CED|cytochrome c                                            102  1e-20
tr|A5ECH7|A5ECH7_BRASB Cytochrome C.                                   102  1e-20
tr|B0IHV5|B0IHV5_RHOPA Cytochrome c class I precursor.                 101  1e-20
prf|1503219A|cytochrome c                                              101  1e-20
sp|P18822|CYC_TRYBB Cytochrome c (Fragments).                          101  1e-20
tr|Q1GVI1|Q1GVI1_SPHAL Cytochrome c, class I precursor.                101  2e-20
tr|Q2TV05|Q2TV05_9RHIZ C-type cytochrome c552.                         101  2e-20
tr|Q1QR79|Q1QR79_NITHX Cytochrome c, class I precursor.                100  3e-20
tr|Q92WZ0|Q92WZ0_RHIME Putative cytochrome c protein.                  100  3e-20
sp|Q8UJ37|CYCM_AGRT5 Cytochrome c homolog.                             100  3e-20
tr|B1WCW6|B1WCW6_OLICA Putative CytoChrome c-like protein.             100  3e-20
tr|Q3KAB4|Q3KAB4_PSEPF Cytochrome c, class I precursor.                100  4e-20
tr|Q0FSB3|Q0FSB3_9RHOB Cytochrome c family protein.                    100  4e-20
prf|3218314AGQ|cytochrome c family protein                             100  4e-20
tr|Q0C4F6|Q0C4F6_HYPNA Cytochrome c family protein.                    100  4e-20
tr|A4Z0V6|A4Z0V6_BRASO Cytochrome C.                                   100  4e-20
tr|Q1QFP6|Q1QFP6_NITHX Cytochrome c, class I precursor.                100  4e-20
tr|A0C010|A0C010_PARTE Chromosome undetermined scaffold_14, whol...    100  5e-20
tr|A3VJS8|A3VJS8_9RHOB Diheme cytochrome c SoxE.                       100  5e-20
tr|Q6N3K0|Q6N3K0_RHOPA Putative cytochrome c precursor.                100  5e-20
tr|Q2VGA8|Q2VGA8_9RHIZ Putative c2-type cytochrome isoform.            100  6e-20
prf|3311456DLR|cytochrome c                                            100  6e-20
tr|A5EEA5|A5EEA5_BRASB Cytochrome c.                                   100  6e-20
tr|Q126Y3|Q126Y3_POLSJ Cytochrome c, class I precursor.                 99  1e-19
tr|A9I4P1|A9I4P1_BORPD Putative cytochrome c.                           99  1e-19
prf|3101377GCF|cytochrome c552                                          99  1e-19
tr|Q5LMM5|Q5LMM5_SILPO Cytochrome c552.                                 99  1e-19
prf|1311229A|cytochrome C2                                              98  1e-19
prf|764652A|cytochrome c                                                98  1e-19
sp|P00079|CYC_TETPY Cytochrome c.                                       98  1e-19
tr|Q1LG27|Q1LG27_RALME Cytochrome c, class I precursor.                 98  2e-19
tr|B0UNK8|B0UNK8_METS4 Cytochrome c class I precursor.                  98  2e-19
tr|Q92SX7|Q92SX7_RHIME PUTATIVE CYTOCHROME C TRANSMEMBRANE PROTEIN.     98  2e-19
prf|3124366PD|cytochrome c2                                             98  2e-19
tr|Q4KJW9|Q4KJW9_PSEF5 Cytochrome c2.                                   98  2e-19
tr|Q0ANL0|Q0ANL0_MARMM Cytochrome c, class I precursor.                 98  2e-19
tr|A8TYT8|A8TYT8_9PROT Cytochrome c.                                    97  3e-19
tr|A6UF14|A6UF14_SINMW Cytochrome c class I precursor.                  97  3e-19
tr|A1B9M7|A1B9M7_PARDP Sulfide dehydrogenase (Flavocytochrome), ...     97  4e-19
sp|P00089|CYC22_RHOFU Cytochrome c2 iso-2.                              97  4e-19
prf|3210325AGX|cytochrome c                                             97  4e-19
tr|Q3YRE5|Q3YRE5_EHRCJ Cytochrome c, class I.                           97  4e-19
tr|B0T1L4|B0T1L4_CAUSK Cytochrome c class I.                            97  4e-19
tr|A9GDV5|A9GDV5_METNO Cytochrome c, class I precursor.                 97  5e-19
tr|Q2GLE8|Q2GLE8_ANAPZ Cytochrome C, membrane-bound.                    97  5e-19
tr|A3W514|A3W514_9RHOB Diheme cytochrome c SoxE.                        97  5e-19
tr|A3JR05|A3JR05_9RHOB Cytochrome c family protein.                     96  5e-19
tr|A6UGH4|A6UGH4_SINMW Cytochrome c class I precursor.                  96  7e-19
sp|P00080|CYC2_RHOGL Cytochrome c2.                                     96  7e-19
tr|A4G566|A4G566_HERAR Putative Cytochrome c.                           96  7e-19
tr|Q2GB57|Q2GB57_NOVAD Cytochrome c, class I.                           96  1e-18
tr|Q2GA61|Q2GA61_NOVAD Cytochrome c, class I precursor.                 96  1e-18
tr|Q1GVI0|Q1GVI0_SPHAL Cytochrome c, class I precursor.                 96  1e-18
pdb|1HRO_B|2.2 | 2| 106|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2; CH...     96  1e-18
pdb|1HRO_A|2.2 | 2| 106|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2; CH...     96  1e-18
tr|A1WBY7|A1WBY7_ACISJ Cytochrome c, class I.                           96  1e-18
tr|Q0JYS2|Q0JYS2_RALEH Cytochrome c2 precursor.                         95  1e-18
tr|Q1N9K5|Q1N9K5_9SPHN Cytochrome c, class I.                           95  1e-18
prf|3311449BAA|cytochrome c                                             95  2e-18
tr|A5CF41|A5CF41_ORITB Cytochrome c.                                    95  2e-18
prf|3101377GXQ|cytochrome c family protein                              95  2e-18
tr|Q5LLH2|Q5LLH2_SILPO Cytochrome c family protein.                     95  2e-18
tr|B2IDY2|B2IDY2_9RHIZ Cytochrome c class I precursor.                  94  3e-18
tr|Q2G7L0|Q2G7L0_NOVAD Cytochrome c, class I precursor.                 94  3e-18
tr|Q92MU4|Q92MU4_RHIME PUTATIVE CYTOCHROME C TRANSMEMBRANE PROTEIN.     94  3e-18
tr|A3JWK3|A3JWK3_9RHOB Cytochrome c family protein.                     94  3e-18
tr|A3UFM2|A3UFM2_9RHOB Cytochrome c, membrane-bound.                    94  4e-18
tr|Q7WLB0|Q7WLB0_BORBR Putative cytochrome c.                           94  4e-18
tr|Q7VX17|Q7VX17_BORPE Putative cytochrome c.                           94  4e-18
tr|B1M1Z4|B1M1Z4_METRJ Cytochrome c class I precursor.                  94  4e-18
tr|B0UGW3|B0UGW3_METS4 Cytochrome c class I precursor.                  94  4e-18
tr|A6E560|A6E560_9RHOB Diheme cytochrome c SoxE.                        94  4e-18
prf|1712131A|cytochrome c550                                            94  4e-18
sp|P23021|CY550_THINO Cytochrome c-550 (Cytochrome c550) (Fragme...     94  4e-18
tr|A1B9M6|A1B9M6_PARDP Sulfur dehydrogenase subunit SoxD precurs...     94  4e-18
tr|B1TMR9|B1TMR9_METSI Cytochrome c class I precursor.                  93  5e-18
prf|2319288E|cytochrome                                                 93  5e-18
tr|A3KAU5|A3KAU5_9RHOB Cytochrome c family protein.                     93  5e-18
tr|A3SHJ5|A3SHJ5_9RHOB Putative uncharacterized protein.                93  5e-18
tr|A3VSC6|A3VSC6_9PROT Cytochrome c, class I.                           93  5e-18
prf|2619324L|cytochrome                                                 93  5e-18
prf|2619324K|cytochrome                                                 93  5e-18
prf|2319288D|cytochrome                                                 93  5e-18
tr|O33435|O33435_PARDE Cytochrome.                                      93  5e-18
tr|O07819|O07819_PARDE Cytochrome.                                      93  5e-18
prf|2723301K|flavocytochrome c                                          93  6e-18
tr|Q939T7|Q939T7_RHOSU Flavocytochrome c cytochrome subunit.            93  6e-18
tr|Q46VJ6|Q46VJ6_RALEJ Cytochrome c, class I.                           93  6e-18
tr|A9VZK9|A9VZK9_METEX Cytochrome c class I precursor.                  93  6e-18
tr|A7W3Y2|A7W3Y2_METCH Cytochrome c, class I precursor.                 93  6e-18
tr|A3KAW5|A3KAW5_9RHOB WD domain/cytochrome c family protein.           93  6e-18
tr|Q0FS91|Q0FS91_9RHOB WD domain/cytochrome c family protein.           93  6e-18
prf|3302410BWA|cytochrome c2                                            93  6e-18
tr|Q16A42|Q16A42_ROSDO Cytochrome c2.                                   93  6e-18
tr|A7HPP0|A7HPP0_PARL1 Cytochrome c class I precursor.                  93  6e-18
tr|A9HMM1|A9HMM1_METNO Cytochrome c precursor.                          93  7e-18
tr|A6FWD1|A6FWD1_9RHOB Sulfur oxidation protein SoxY.                   93  7e-18
tr|A5G0B6|A5G0B6_ACICJ Cytochrome c, class I precursor.                 93  8e-18
tr|Q7W7X0|Q7W7X0_BORPA Putative cytochrome c.                           92  8e-18
tr|A9FGZ6|A9FGZ6_9RHOB Diheme cytochrome c SoxD.                        92  9e-18
tr|A4XFG5|A4XFG5_NOVAD Cytochrome c, class I precursor.                 92  9e-18
tr|A5FTZ2|A5FTZ2_ACICJ Cytochrome c, class I precursor.                 92  9e-18
tr|A9HWA3|A9HWA3_9RHOB Cytochrome c2.                                   92  1e-17
tr|B0ULC2|B0ULC2_METS4 Cytochrome c class I precursor.                  92  1e-17
tr|Q2GCC9|Q2GCC9_NOVAD Cytochrome c, class I precursor.                 92  1e-17
prf|3311456NQM|cytochrome c                                             92  1e-17
tr|A5ERZ5|A5ERZ5_BRASB Cytochrome c.                                    92  1e-17
tr|Q47FP8|Q47FP8_DECAR Cytochrome c, class I precursor.                 92  1e-17
tr|A0NXV5|A0NXV5_9RHOB Diheme cytochrome c SoxD.                        92  1e-17
tr|Q1YKE8|Q1YKE8_9RHIZ Putative cytochrome c.                           92  1e-17
tr|B1LWI4|B1LWI4_METRJ Cytochrome c class I precursor.                  92  1e-17
prf|3101377AYL|diheme cytochrome c                                      92  1e-17
tr|Q5LUQ3|Q5LUQ3_SILPO Diheme cytochrome c SoxE.                        92  1e-17
tr|A4GIG4|A4GIG4_9BACT WD domain/cytochrome C family protein.           92  2e-17
tr|A9F4N3|A9F4N3_9RHOB Cytochrome c family protein.                     91  2e-17
tr|B1CUX1|B1CUX1_RHILT Cytochrome c class I precursor.                  91  2e-17
tr|A3JNU1|A3JNU1_9RHOB Cytochrome c552.                                 91  3e-17
tr|B1LVX4|B1LVX4_METRJ Cytochrome c class I precursor.                  91  3e-17
tr|A5FW83|A5FW83_ACICJ Cytochrome c, class I.                           91  3e-17
tr|A3WE73|A3WE73_9SPHN Cytochrome C.                                    91  3e-17
tr|A8TII4|A8TII4_9PROT Isopropylmalate isomerase small subunit (...     91  3e-17
tr|Q1V1R6|Q1V1R6_9RICK Cytochrome C.                                    91  3e-17
tr|A6UC76|A6UC76_SINMW Cytochrome c class I precursor.                  91  3e-17
tr|B0J2R9|B0J2R9_RHILT Cytochrome c class I precursor.                  91  4e-17
tr|A9FKB5|A9FKB5_9RHOB Diheme cytochrome c SoxD.                        91  4e-17
sp|P00088|CYC22_RHOMO Cytochrome c2 iso-2.                              90  4e-17
tr|Q210C1|Q210C1_RHOPB Cytochrome c, class I precursor.                 90  4e-17
tr|Q5GTG0|Q5GTG0_WOLTR Cytochrome c2.                                   90  6e-17
prf|3122318YT|cytochrome c                                              90  6e-17
tr|Q4FNB3|Q4FNB3_PELUB Cytochrome C.                                    90  6e-17
tr|B1WJW7|B1WJW7_OLICA Cytochrome c2.                                   90  6e-17
tr|A3W515|A3W515_9RHOB Diheme cytochrome c SoxD.                        90  6e-17
tr|Q2N842|Q2N842_ERYLH Cytochrome C.                                    90  6e-17
tr|A9DG76|A9DG76_9RHIZ Probable sulfite oxidase cytochrome subunit.     90  7e-17
prf|1803359A|cytochrome c                                               89  7e-17
sp|P30323|CYCM_BRAJA Cytochrome c homolog.                              89  7e-17
tr|A9CGJ2|A9CGJ2_AGRT5 Cytochrome c2.                                   89  7e-17
tr|A4ETC2|A4ETC2_9RHOB Cytochrome c family protein.                     89  8e-17
tr|A5VMY9|A5VMY9_BRUO2 Cytochrome c, membrane-bound.                    89  8e-17
tr|Q8G3B1|Q8G3B1_BRUSU Cytochrome c, membrane-bound.                    89  9e-17
tr|B0CI59|B0CI59_BRUSI Cytochrome c.                                    89  9e-17
tr|A9M6P4|A9M6P4_BRUC2 Cytochrome c.                                    89  9e-17
prf|3110385AP|cytochrome c                                              89  9e-17
tr|Q8YEH5|Q8YEH5_BRUME CYTOCHROME C-552.                                89  9e-17
tr|Q57FX5|Q57FX5_BRUAB Cytochrome c, membrane-bound.                    89  9e-17
tr|Q2YPQ4|Q2YPQ4_BRUA2 Cytochrome c heme-binding site:Cytochrome...     89  9e-17
tr|Q21QW9|Q21QW9_RHOFD Cytochrome c, class I precursor.                 89  1e-16
tr|A3SQC7|A3SQC7_9RHOB Cytochrome c552.                                 89  1e-16
prf|3207409EFD|cytochrome c                                             89  1e-16
tr|Q2K6Z6|Q2K6Z6_RHIEC Probable cytochrome-c protein.                   89  1e-16
tr|A7IIN0|A7IIN0_XANP2 Cytochrome c class I.                            89  1e-16
prf|3206311AJQ|cytochrome c-like protein                                89  1e-16
tr|Q5FG01|Q5FG01_EHRRG Cytochrome c homolog.                            89  1e-16
prf|3206311CJE|cytochrome c-like protein                                89  1e-16
prf|3103440AHH|c-type cytochrome                                        89  1e-16
tr|Q5HAK9|Q5HAK9_EHRRW Putative c-type cytochrome (Cytochrome c ...     89  1e-16
prf|3302410BXV|cytochrome c2                                            89  1e-16
tr|Q16A02|Q16A02_ROSDO Cytochrome c2.                                   89  1e-16
tr|Q2GHD6|Q2GHD6_EHRCR Cytochrome C, membrane-bound.                    89  1e-16
tr|Q40IT9|Q40IT9_EHRCH Cytochrome c, class I.                           89  1e-16
tr|Q1YN57|Q1YN57_9RHIZ Diheme cytochrome c SoxD.                        89  1e-16
tr|B1ZJ24|B1ZJ24_METPB Cytochrome c class I precursor.                  89  1e-16
prf|3216294DTC|cytochrome c                                             89  1e-16
tr|Q3J003|Q3J003_RHOS4 Cytochrome cy.                                   89  1e-16
tr|A3PM96|A3PM96_RHOS1 Cytochrome c, class I precursor.                 89  1e-16
tr|Q884L8|Q884L8_PSESM Cytochrome c2.                                   89  1e-16
tr|A4YLZ0|A4YLZ0_BRASO Cytochrome c homolog.                            89  1e-16
tr|B0KNJ6|B0KNJ6_PSEPG Cytochrome c class I precursor.                  89  1e-16
tr|A1FUA4|A1FUA4_XANMA Cytochrome c, class I precursor.                 89  1e-16
tr|A9HHD0|A9HHD0_9RHOB Cytochrome c2.                                   88  2e-16
tr|A1UU31|A1UU31_BARBK Cytochrome c family protein.                     88  2e-16
prf|3103441EV|cytochrome c                                              88  2e-16
tr|Q5PBL1|Q5PBL1_ANAMM Cytochrome C.                                    88  2e-16
tr|A3X8I7|A3X8I7_9RHOB Diheme cytochrome c SoxD.                        88  2e-16
tr|A9DW48|A9DW48_9RHOB Cytochrome c, class I.                           88  2e-16
tr|B2FHG3|B2FHG3_XANMA Putative cytochrome c precursor.                 88  2e-16
tr|A8LJ38|A8LJ38_DINSH Cytochrome c class I precursor.                  88  2e-16
tr|A4WTX3|A4WTX3_RHOS5 Cytochrome c, class I precursor.                 88  2e-16
tr|Q73GX6|Q73GX6_WOLPM Cytochrome c family protein.                     88  2e-16
tr|Q4E942|Q4E942_9RICK Cytochrome c family protein.                     88  2e-16
tr|Q4E810|Q4E810_9RICK Cytochrome c family protein.                     88  2e-16
tr|Q133I0|Q133I0_RHOPS Cytochrome c, class I precursor.                 88  2e-16
prf|3117431CUE|cytochrome c                                             88  2e-16
tr|Q4ZV95|Q4ZV95_PSEU2 Cytochrome c, class I precursor.                 88  2e-16
tr|B1Z8Y0|B1Z8Y0_METPB Cytochrome c class I precursor.                  88  2e-16
tr|A7CLC2|A7CLC2_BURPI Cytochrome c, class I.                           87  3e-16
prf|3101377AYK|diheme cytochrome c                                      87  3e-16
tr|Q5LUQ4|Q5LUQ4_SILPO Diheme cytochrome c SoxD.                        87  3e-16
tr|A5VBD5|A5VBD5_SPHWW Cytochrome c, class I precursor.                 87  3e-16
tr|Q2CI91|Q2CI91_9RHOB Diheme cytochrome c SoxD.                        87  3e-16
sp|P00081|CYC2_AGRTC Cytochrome c2.                                     87  3e-16
tr|A4U4B4|A4U4B4_9PROT Cytochrome c.                                    87  3e-16
tr|Q11AX3|Q11AX3_MESSB Cytochrome c, class I.                           87  3e-16
tr|A1WIA2|A1WIA2_VEREI Sulfite dehydrogenase (Cytochrome) subuni...     87  3e-16
tr|A6UMP0|A6UMP0_SINMW Cytochrome c class I precursor.                  87  4e-16
prf|3121275BNE|cytochrome c2                                            87  4e-16
tr|Q2W7W2|Q2W7W2_MAGMM Cytochrome C2.                                   87  4e-16
tr|A6DWZ4|A6DWZ4_9RHOB WD domain/cytochrome c family protein.           87  4e-16
tr|A3VZV8|A3VZV8_9RHOB WD domain/cytochrome c family protein.           87  4e-16
tr|A3JNF3|A3JNF3_9RHOB Cytochrome c family protein.                     87  4e-16
tr|A9W173|A9W173_METEX Cytochrome c class I precursor.                  87  4e-16
tr|A7W7V1|A7W7V1_METCH Cytochrome c, class I precursor.                 87  4e-16
pdb|1QN2_C|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH; CH...     87  5e-16
pdb|1QN2_B|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH; CH...     87  5e-16
pdb|1QN2_A|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH; CH...     87  5e-16
tr|Q7SIA4|Q7SIA4_METEX Cytochrome.                                      87  5e-16
tr|Q1GWW7|Q1GWW7_SPHAL Cytochrome c, class I.                           86  6e-16
prf|3216294BHY|iso-cytochrome c2                                        86  6e-16
prf|1907189A|iso-cytochrome c2                                          86  6e-16
tr|Q3J3A0|Q3J3A0_RHOS4 Isocytochrome c2.                                86  6e-16
tr|Q53144|Q53144_RHOSH Isocytochrome c2 precursor (Cytochrome c).       86  6e-16
tr|A3PJ29|A3PJ29_RHOS1 Cytochrome c, class I precursor.                 86  6e-16
tr|A0NUZ1|A0NUZ1_9RHOB Cytochrome c family protein.                     86  7e-16
prf|3218314AVC|cytochrome c family protein                              86  7e-16
tr|Q0C3Q4|Q0C3Q4_HYPNA Cytochrome c family protein.                     86  7e-16
tr|A0NZM4|A0NZM4_9RHOB Cytochrome c family protein.                     86  7e-16
tr|Q4PJF4|Q4PJF4_9BACT Predicted WD domain/cytochrome C family p...     86  7e-16
tr|B1WM54|B1WM54_OLICA Copper-containing nitrite reductase (EC 1...     86  8e-16
tr|Q2GDT8|Q2GDT8_NEOSM Cytochrome c.                                    86  8e-16
tr|B1DMR8|B1DMR8_9RHOO Cytochrome c class I.                            86  8e-16
tr|A3XC88|A3XC88_9RHOB Cytochrome c552.                                 86  8e-16
tr|A1HGU7|A1HGU7_BURPI Cytochrome c, class I precursor.                 86  8e-16
tr|A9HF42|A9HF42_METNO WD-40 repeat precursor.                          86  8e-16
prf|2119163A|cytochrome c550                                            86  8e-16
tr|Q1GDI1|Q1GDI1_SILST Cytochrome c class I.                            86  9e-16
prf|3302410BVY|diheme cytochrome c                                      86  9e-16
tr|Q16A43|Q16A43_ROSDO Diheme cytochrome c SoxD.                        86  9e-16
prf|2513497A|Cytochrome c-y                                             86  9e-16
tr|O85794|O85794_RHOSH Cytochrome c-type cyt cy.                        86  9e-16
prf|3119377CNV|cytochrome c2                                            86  9e-16
tr|Q48KK4|Q48KK4_PSE14 Cytochrome c2.                                   86  9e-16
tr|A9FV40|A9FV40_9RHOB Cytochrome c, class I.                           86  9e-16
tr|A3WHR7|A3WHR7_9SPHN Cytochrome c family protein.                     86  1e-15
tr|A9HRF3|A9HRF3_9RHOB Cytochrome c552.                                 86  1e-15
prf|3323271DRT|cytochrome c protein                                     86  1e-15
tr|Q0FNL8|Q0FNL8_9RHOB Cytochrome cy.                                   86  1e-15
tr|A8I5P2|A8I5P2_AZOC5 Putative cytochrome c protein.                   86  1e-15
tr|A4XEH9|A4XEH9_NOVAD Cytochrome c, class I precursor.                 86  1e-15
tr|A6FW74|A6FW74_9RHOB Cytochrome c552.                                 86  1e-15
tr|A9DG73|A9DG73_9RHIZ Cytochrome c2.                                   86  1e-15
tr|A6FWD0|A6FWD0_9RHOB Diheme cytochrome c SoxD.                        85  1e-15
tr|A6FU36|A6FU36_9RHOB WD domain/cytochrome c family protein.           85  1e-15
pdb|1I6E_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     85  1e-15
pdb|1I6D_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     85  1e-15
pdb|1C7M_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     85  1e-15
tr|Q0F958|Q0F958_9RHOB Diheme cytochrome c SoxD.                        85  2e-15
tr|B0T1W7|B0T1W7_CAUSK Cytochrome c class I precursor.                  85  2e-15
tr|A6E559|A6E559_9RHOB Diheme cytochrome c SoxD.                        85  2e-15
tr|A6E1S6|A6E1S6_9RHOB Cytochrome cy.                                   85  2e-15
tr|Q1YHL0|Q1YHL0_9RHIZ Cytochrome c.                                    85  2e-15
prf|1911238A|cytochrome cy                                              85  2e-15
sp|Q05389|CYCY_RHOCA Cytochrome c-type cyt cy.                          85  2e-15
tr|Q1MEU1|Q1MEU1_RHIL3 Putative exported cytochrome c precursor.        85  2e-15
tr|A3VES6|A3VES6_9RHOB Cytochrome cy.                                   84  2e-15
prf|3101377CNV|WD domain/cytochrome c family protein                    84  3e-15
tr|Q5LSH5|Q5LSH5_SILPO WD domain/cytochrome c family protein.           84  3e-15
tr|Q1NED3|Q1NED3_9SPHN Cytochrome c family protein.                     84  3e-15
prf|2705259WV|cytochrome c                                              84  3e-15
tr|Q98LF0|Q98LF0_RHILO Cytochrome c.                                    84  3e-15
tr|A3WR51|A3WR51_9BRAD Cytochrome c oxidase assembly protein ctag.      84  3e-15
prf|3206257AKF|cytochrome c                                             84  3e-15
tr|Q3SUR3|Q3SUR3_NITWN Cytochrome c, class I.                           84  3e-15
sp|Q92IT3|CYCM_RICCN Cytochrome c homolog.                              84  3e-15
tr|B0T5J3|B0T5J3_CAUSK Cytochrome c class I precursor.                  84  3e-15
tr|A0NUL1|A0NUL1_9RHOB Cytochrome c.                                    84  3e-15
tr|Q0FDA8|Q0FDA8_9RHOB Cytochrome c552.                                 84  3e-15
tr|A6WUU3|A6WUU3_OCHA4 Cytochrome c class I precursor.                  84  4e-15
prf|3302410AVN|WD repeat protein                                        84  4e-15
tr|Q16BI6|Q16BI6_ROSDO WD repeat protein.                               84  4e-15
tr|Q2LAG8|Q2LAG8_RHOSH Cytochrome cY.                                   84  4e-15
tr|A4WPW7|A4WPW7_RHOS5 Cytochrome c, class I precursor.                 84  4e-15
tr|A3SJR4|A3SJR4_9RHOB WD domain/cytochrome c family protein.           84  4e-15
tr|A1B311|A1B311_PARDP Cytochrome c, class I precursor.                 84  4e-15
tr|A6X352|A6X352_OCHA4 Cytochrome c class I precursor.                  84  4e-15
sp|Q4UKP6|CYCM_RICFE Cytochrome c homolog.                              84  4e-15
prf|2116265A|cytochrome c552                                            84  4e-15
sp|P54820|CY552_PARDE Cytochrome c-552 (Cytochrome c552).               84  4e-15
tr|Q1YLF0|Q1YLF0_9RHIZ Possible cytochrome c with WD-repeat domain.     84  4e-15
tr|A8EY03|A8EY03_RICCK Cytochrome c.                                    84  5e-15
tr|A9CVU4|A9CVU4_9RHIZ Putative cytochrome c transmembrane protein.     83  5e-15
prf|3302410BHY|cytochrome c552                                          83  5e-15
tr|Q9A7T8|Q9A7T8_CAUCR Cytochrome c family protein.                     83  5e-15
tr|Q16AT5|Q16AT5_ROSDO Cytochrome c552.                                 83  5e-15
tr|B0BWS6|B0BWS6_RICRO Cytochrome c.                                    83  6e-15
tr|A8GRC5|A8GRC5_RICRS Cytochrome c.                                    83  6e-15
tr|A3W948|A3W948_9RHOB Cytochrome cy.                                   83  6e-15
tr|A3SZG8|A3SZG8_9RHOB Diheme cytochrome c SoxD.                        83  6e-15
pdb|1QL4_D|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL4_C|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL4_B|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL4_A|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL3_D|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL3_C|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL3_B|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
pdb|1QL3_A|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552; ...     83  6e-15
tr|A8GMQ4|A8GMQ4_RICAH Cytochrome c.                                    83  8e-15
tr|A8TRQ2|A8TRQ2_9PROT WD domain/cytochrome c family protein.           82  8e-15
tr|Q1QHU4|Q1QHU4_NITHX Cytochrome c, class I.                           82  8e-15
tr|A4EWF2|A4EWF2_9RHOB Cytochrome c552.                                 82  8e-15
prf|3323271BMU|cytochrome c                                             82  9e-15
tr|A8I0F1|A8I0F1_AZOC5 Cytochrome c.                                    82  9e-15
tr|A9FY10|A9FY10_9RHOB Cytochrome c552.                                 82  9e-15
tr|A9EI07|A9EI07_9RHOB Cytochrome c552.                                 82  9e-15
tr|A3K9X0|A3K9X0_9RHOB Diheme cytochrome c SoxD.                        82  9e-15
tr|Q0FFM7|Q0FFM7_9RHOB Diheme cytochrome c SoxE.                        82  1e-14
tr|A3SZG7|A3SZG7_9RHOB Diheme cytochrome c SoxE.                        82  1e-14
tr|A8LLZ3|A8LLZ3_DINSH Cytochrome c class I precursor.                  82  1e-14
tr|A9HWA5|A9HWA5_9RHOB Diheme cytochrome c SoxD.                        82  1e-14
tr|A8GWA2|A8GWA2_RICB8 Cytochrome c.                                    82  1e-14
sp|Q1RHX7|CYCM_RICBR Cytochrome c homolog.                              82  1e-14
tr|Q02A35|Q02A35_SOLUE Cytochrome c, class I precursor.                 82  1e-14
tr|Q7PB75|Q7PB75_RICSI Cytochrome c.                                    82  1e-14
tr|B0UML1|B0UML1_METS4 Cytochrome c class I precursor.                  82  1e-14
tr|Q1GJM9|Q1GJM9_SILST Cytochrome c class I.                            82  1e-14
tr|Q0G146|Q0G146_9RHIZ WD domain/cytochrome c family protein.           82  1e-14
prf|3403416LG|cytochrome c                                              82  1e-14
tr|A9IMZ7|A9IMZ7_BART1 Cytochrome c.                                    82  1e-14
tr|A9EJC8|A9EJC8_9RHOB WD domain/cytochrome c family protein.           82  2e-14
prf|3017390KR|cytochrome c                                              82  2e-14
sp|Q68XB6|CYCM_RICTY Cytochrome c homolog.                              82  2e-14
tr|Q1QQF8|Q1QQF8_NITHX Cytochrome c oxidase assembly protein Cta...     82  2e-14
prf|2705259GYM|cytochrome c                                             81  2e-14
tr|Q98BN4|Q98BN4_RHILO Cytochrome c.                                    81  2e-14
prf|3103367GCF|cytochrome c                                             81  2e-14
tr|Q5NZC9|Q5NZC9_AZOSE Putative cytochrome c.                           81  2e-14
tr|A9HVI3|A9HVI3_9RHOB Cytochrome c family protein.                     81  2e-14
prf|3018370CKT|ORF                                                      81  2e-14
tr|Q6G0M3|Q6G0M3_BARQU Putative uncharacterized protein.                81  2e-14
tr|Q2CDL8|Q2CDL8_9RHOB Cytochrome c552.                                 81  3e-14
tr|A9H3Q9|A9H3Q9_9RHOB WD repeat protein.                               81  3e-14
tr|A5CFT9|A5CFT9_9ZZZZ Putative uncharacterized protein.                80  3e-14
prf|2705259FYN|cytochrome c                                             80  3e-14
tr|Q98D16|Q98D16_RHILO Cytochrome c-1.                                  80  3e-14
tr|A3TVM5|A3TVM5_9RHOB Cytochrome cy.                                   80  4e-14
tr|Q47E63|Q47E63_DECAR Cytochrome c, class I precursor.                 80  4e-14
tr|Q5ZQM8|Q5ZQM8_9RHIZ SoxD protein.                                    80  4e-14
tr|Q1MGD7|Q1MGD7_RHIL3 Putative cytochrome c precursor.                 80  4e-14
tr|A4G3C5|A4G3C5_HERAR Putative cytochrome c.                           80  4e-14
tr|Q11E81|Q11E81_MESSB Cytochrome c, class I precursor.                 80  5e-14
prf|3302410AQA|cytochrome c family protein                              80  5e-14
tr|Q16BT6|Q16BT6_ROSDO Cytochrome c family protein.                     80  5e-14
tr|Q1MN22|Q1MN22_RHIL3 Putative cytochrome c precursor.                 80  5e-14
tr|Q8W8K8|Q8W8K8_9CARA Cytochrome C (Fragment).                         80  6e-14
tr|A3K3D5|A3K3D5_9RHOB Cytochrome c552.                                 80  6e-14
tr|A8LJ39|A8LJ39_DINSH Cytochrome c class I precursor.                  80  6e-14
tr|A8TP70|A8TP70_9PROT Probable sulfite oxidase cytochrome subunit.     80  6e-14
tr|A6SVY9|A6SVY9_JANMA Cytochrome c2.                                   80  7e-14
tr|A8F114|A8F114_RICM5 Cytochrome c.                                    79  7e-14
tr|A3WUV0|A3WUV0_9BRAD Cytochrome c, class I.                           79  7e-14
tr|A0NY63|A0NY63_9RHOB WD domain/cytochrome c family protein.           79  8e-14
tr|B2ID00|B2ID00_9RHIZ Cytochrome c class I precursor.                  79  8e-14
tr|B0IZY4|B0IZY4_RHILT Cytochrome c class I.                            79  8e-14
prf|2424426KY|cytochrome c                                              79  9e-14
sp|Q9ZDS2|CYCM_RICPR Cytochrome c homolog.                              79  9e-14
prf|3207409EP|cytochrome c                                              79  1e-13
tr|Q2KDX8|Q2KDX8_RHIEC Cytochrome-c protein.                            79  1e-13
tr|A7IG94|A7IG94_XANP2 Cytochrome c class I precursor.                  79  1e-13
tr|A7IMT2|A7IMT2_XANP2 Cytochrome c class I precursor.                  79  1e-13
prf|3311456MKC|cytochrome c2                                            79  1e-13
tr|A5EQ92|A5EQ92_BRASB Cytochrome c2.                                   79  1e-13
tr|A3S8H0|A3S8H0_9RHOB Cytochrome c552.                                 79  1e-13
tr|Q0FI42|Q0FI42_9RHOB Diheme cytochrome c SoxD.                        79  1e-13
tr|Q8WBF2|Q8WBF2_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8WBF0|Q8WBF0_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8WBD8|Q8WBD8_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8W920|Q8W920_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8W919|Q8W919_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8W918|Q8W918_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|A9D291|A9D291_9RHIZ Cytochrome cy.                                   79  1e-13
tr|A3VPW9|A3VPW9_9PROT Cytochrome C.                                    79  1e-13
prf|3121275GAR|cytochrome c2                                            79  1e-13
tr|Q2W1P5|Q2W1P5_MAGMM Cytochrome C2, iso-2.                            79  1e-13
tr|Q8WBE2|Q8WBE2_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8W892|Q8W892_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|Q8W891|Q8W891_9CARA Cytochrome C (Fragment).                         79  1e-13
tr|A8LQB4|A8LQB4_DINSH Cytochrome c class I precursor.                  79  1e-13
tr|B1M6T4|B1M6T4_METRJ Cytochrome c class I precursor.                  78  2e-13
prf|3008327W|cytochrome c2                                              78  2e-13
tr|Q8VUB4|Q8VUB4_BRASO Cytochrome C2.                                   78  2e-13
tr|Q8WBF7|Q8WBF7_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBF5|Q8WBF5_9CARA Cytochrome C (Fragment).                         78  2e-13
prf|3018370JW|ORF                                                       78  2e-13
tr|Q6G4U5|Q6G4U5_BARHE Putative uncharacterized protein.                78  2e-13
sp|P00093|CYC2_RHOPH Cytochrome c2.                                     78  2e-13
tr|Q8WBE1|Q8WBE1_9CARA Cytochrome C (Fragment).                         78  2e-13
prf|3401267DBM|cytochrome c                                             78  2e-13
tr|Q0BQL2|Q0BQL2_GRABC Cytochrome c.                                    78  2e-13
tr|Q8WBG2|Q8WBG2_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBG1|Q8WBG1_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBF8|Q8WBF8_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBF3|Q8WBF3_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBF1|Q8WBF1_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBE5|Q8WBE5_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBE3|Q8WBE3_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBE0|Q8WBE0_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8WBD9|Q8WBD9_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W966|Q8W966_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W965|Q8W965_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W964|Q8W964_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W963|Q8W963_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W962|Q8W962_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W961|Q8W961_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q8W960|Q8W960_9CARA Cytochrome C (Fragment).                         78  2e-13
tr|Q2N7K5|Q2N7K5_ERYLH Cytochrome c family protein.                     78  2e-13
tr|Q1QND2|Q1QND2_NITHX Cytochrome c, class I precursor.                 78  2e-13
tr|A8STD6|A8STD6_RIFPA Cytochrome c (Fragment).                         78  2e-13
tr|A3STD1|A3STD1_9RHOB Cytochrome c552.                                 78  2e-13
prf|3221371QRP|cytochrome c                                             77  3e-13
tr|Q13IC5|Q13IC5_BURXL Putative cytochrome c.                           77  3e-13
tr|Q8WBE8|Q8WBE8_9CARA Cytochrome C (Fragment).                         77  3e-13
tr|A5WCQ2|A5WCQ2_PSYWF Cytochrome c, class I.                           77  3e-13
tr|Q8WBD7|Q8WBD7_9CARA Cytochrome C (Fragment).                         77  3e-13
tr|A9E7B1|A9E7B1_9RHOB Diheme cytochrome c SoxD.                        77  3e-13
tr|Q8W8L0|Q8W8L0_9CARA Cytochrome C (Fragment).                         77  4e-13
tr|Q8WBE4|Q8WBE4_9CARA Cytochrome C (Fragment).                         77  5e-13
tr|Q8W7D0|Q8W7D0_9CARA Cytochrome C (Fragment).                         77  5e-13
tr|B1CGP0|B1CGP0_RHILT Cytochrome c class I precursor.                  77  5e-13
tr|Q7BQQ3|Q7BQQ3_XANAU Putative cytochrome C protein.                   77  6e-13
tr|Q0G805|Q0G805_9RHIZ Cytochrome c family protein.                     76  6e-13
tr|Q89SL2|Q89SL2_BRAJA Cytochrome c2.                                   76  6e-13
tr|Q8WBF4|Q8WBF4_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8W967|Q8W967_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8W959|Q8W959_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8W958|Q8W958_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8W957|Q8W957_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8W956|Q8W956_9CARA Cytochrome C (Fragment).                         76  6e-13
tr|Q8WBE9|Q8WBE9_9CARA Cytochrome C (Fragment).                         76  7e-13
tr|Q8WBE7|Q8WBE7_9CARA Cytochrome C (Fragment).                         76  7e-13
tr|Q8W8D5|Q8W8D5_9CARA Cytochrome C (Fragment).                         76  7e-13
tr|A3SQX3|A3SQX3_9RHOB Diheme cytochrome c SoxD.                        76  7e-13
tr|A3WF82|A3WF82_9SPHN Diheme cytochrome c SoxD.                        76  7e-13
sp|P00087|CYC21_RHOMO Cytochrome c2 iso-1.                              76  7e-13
tr|Q0ASL3|Q0ASL3_MARMM Cytochrome c, class I.                           76  8e-13
tr|A9CFY9|A9CFY9_AGRT5 Cytochrome c2.                                   76  8e-13
tr|Q8WBF6|Q8WBF6_9CARA Cytochrome C (Fragment).                         76  9e-13
prf|3323271FRW|c-type cytochrome                                        76  1e-12
tr|A8IHH4|A8IHH4_AZOC5 Putative c-type cytochrome.                      76  1e-12
tr|Q8WBE6|Q8WBE6_9CARA Cytochrome C (Fragment).                         75  1e-12
tr|B1M7W5|B1M7W5_METRJ Cytochrome c class I precursor.                  75  1e-12
tr|A3VJS7|A3VJS7_9RHOB Diheme cytochrome c SoxD.                        75  1e-12
tr|A5VDV6|A5VDV6_SPHWW Cytochrome c, class I precursor.                 75  2e-12
tr|Q2BKI9|Q2BKI9_9GAMM Cytochrome c2.                                   75  2e-12
tr|Q8WBF9|Q8WBF9_9CARA Cytochrome C (Fragment).                         75  2e-12
tr|Q0FCL5|Q0FCL5_9RHOB Cytochrome c.                                    75  2e-12
tr|A4YN71|A4YN71_BRASO Cytochrome c.                                    75  2e-12
tr|A3SZ20|A3SZ20_9RHOB Diheme cytochrome c SoxD.                        74  2e-12
tr|Q92YQ4|Q92YQ4_RHIME Probable c-type cytochrome.                      74  3e-12
tr|Q8W7I9|Q8W7I9_9CARA Cytochrome C (Fragment).                         74  3e-12
tr|Q8PLV5|Q8PLV5_XANAC Cytochrome C2.                                   74  3e-12
prf|2705259CNN|cytochrome c2                                            74  3e-12
tr|Q98HR1|Q98HR1_RHILO Cytochrome c2.                                   74  3e-12
tr|Q1LW96|Q1LW96_DANRE Novel protein similar to vertebrate cytoc...     74  4e-12
tr|B0T1U1|B0T1U1_CAUSK Cytochrome c class I.                            74  4e-12
prf|1309234A|cytochrome c550                                            74  4e-12
sp|P12832|CY550_AQUIT Cytochrome c-550 (Cytochrome c550).               74  4e-12
tr|A8LNU8|A8LNU8_DINSH Cytochrome c class I precursor.                  74  5e-12
tr|Q1Q9D0|Q1Q9D0_PSYCK Cytochrome c, class I precursor.                 74  5e-12
prf|3122281DAA|cytochrome c precursor                                   73  6e-12
tr|Q3BUW2|Q3BUW2_XANC5 Putative cytochrome C precursor.                 73  6e-12
tr|Q588Z0|Q588Z0_9SPHN Probable cytochrome c.                           73  6e-12
sp|P00086|CYC21_RHOFU Cytochrome c2 iso-1.                              73  6e-12
tr|Q4FR33|Q4FR33_PSYAR Cytochrome C2.                                   73  6e-12
prf|3323271AXP|cytochrome c                                             72  9e-12
tr|A8HUL3|A8HUL3_AZOC5 Cytochrome c.                                    72  9e-12
tr|Q9A4A2|Q9A4A2_CAUCR Cytochrome c, membrane-bound.                    72  9e-12
tr|A7W3A8|A7W3A8_METCH Cytochrome c, class I.                           72  1e-11
tr|Q219R7|Q219R7_RHOPB Cytochrome c, class I precursor.                 72  1e-11
tr|A9W6M8|A9W6M8_METEX WD-40 repeat protein precursor.                  72  1e-11
tr|A4EE76|A4EE76_9RHOB Cytochrome c, class I.                           71  2e-11
tr|A5V904|A5V904_SPHWW Cytochrome c, class I precursor.                 71  2e-11
sp|P81153|CYC21_RHOCE Cytochrome c2 iso-1 (Cytochrome c552).            71  2e-11
prf|2416294A|cytochrome c2                                              71  3e-11
tr|A0CJR6|A0CJR6_PARTE Chromosome undetermined scaffold_2, whole...     71  3e-11
prf|3401267AKH|cytochrome c oxidase assembly protein                    71  3e-11
tr|Q0BU92|Q0BU92_GRABC Cytochrome c oxidase assembly protein ctaG.      71  3e-11
tr|Q28KI1|Q28KI1_JANSC Cytochrome c class I.                            71  3e-11
tr|Q11FK1|Q11FK1_MESSB WD-40 repeat precursor.                          71  3e-11
tr|A3SED5|A3SED5_9RHOB Diheme cytochrome c SoxD.                        70  4e-11
tr|Q8WBG0|Q8WBG0_9CARA Cytochrome C (Fragment).                         70  4e-11
tr|A5PAE9|A5PAE9_9SPHN Cytochrome c, class I.                           70  4e-11
tr|Q89IZ9|Q89IZ9_BRAJA Bll5485 protein.                                 70  4e-11
prf|681066A|cytochrome c2                                               70  4e-11
pdb|3C2C  |1.68| 1| 112|N|CYTOCHROME $C=2= (REDUCED)            ...     70  4e-11
pdb|2C2C  |2.0 | 1| 112|N|CYTOCHROME $C=2= (OXIDIZED)           ...     70  4e-11
sp|P0C189|CYC2_RHORU Cytochrome c2.                                     70  4e-11
tr|B1ZFG4|B1ZFG4_METPB Cytochrome c class I precursor.                  70  5e-11
tr|Q07RZ1|Q07RZ1_RHOP5 Cytochrome c, class I precursor.                 70  5e-11
tr|A7AP89|A7AP89_BABBO Cytochrome c family protein.                     69  7e-11
tr|A3V771|A3V771_9RHOB Cytochrome cy.                                   69  7e-11
tr|Q4YUW2|Q4YUW2_PLABE Cytochrome c2,putative.                          69  7e-11
tr|A3V1V4|A3V1V4_9RHOB Putative uncharacterized protein.                69  8e-11
tr|Q89DF1|Q89DF1_BRAJA Cyc1 protein.                                    69  9e-11

Go to top
>prf|1103314A|cytochrome c
          Length = 105

 Score =  216 bits (549), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>tr|Q56A15|Q56A15_MOUSE Cytochrome c, somatic (Adult male kidney
           cDNA, RIKEN full-length enriched library,
           clone:F520003L15 product:cytochrome c, somatic, full
           insert sequence) (ES cells cDNA, RIKEN full-length
           enriched library, clone:2410041L21 product:cytochrome c,
           somatic, full insert sequence) (Adult male cerebellum
           cDNA, RIKEN full-length enriched library,
           clone:1500032A05 product:cytochrome c, somatic, full
           insert sequence) (18-day embryo whole body cDNA, RIKEN
           full-length enriched library, clone:1100001H15
           product:cytochrome c, somatic, full insert sequence)
           (Adult male kidney cDNA, RIKEN full-length enriched
           library, clone:0610031O08 product:cytochrome c, somatic,
           full insert sequence).
          Length = 105

 Score =  216 bits (549), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P62898|CYC_RAT Cytochrome c, somatic.
          Length = 105

 Score =  216 bits (549), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P62897|CYC_MOUSE Cytochrome c, somatic.
          Length = 105

 Score =  216 bits (549), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>prf|0707246A|cytochrome c
          Length = 108

 Score =  216 bits (549), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 4   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 63

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 64  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 108


Go to top
>prf|770880A|cytochrome c
          Length = 104

 Score =  213 bits (542), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 104


Go to top
>sp|P68098|CYC_LAMGU Cytochrome c.
          Length = 105

 Score =  213 bits (541), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P68100|CYC_ESCGI Cytochrome c.
          Length = 105

 Score =  213 bits (541), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P68099|CYC_CAMDR Cytochrome c.
          Length = 105

 Score =  213 bits (541), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>prf|3111412G|mitochondrial cytochrome c somatic
          Length = 105

 Score =  212 bits (540), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTG NLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGXNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|Q52V09|CYC_TARBA Cytochrome c.
          Length = 105

 Score =  212 bits (540), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTG NLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGXNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P00008|CYC_RABIT Cytochrome c.
          Length = 105

 Score =  212 bits (539), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKDERADLIAYLKKATNE 105


Go to top
>prf|1407207B|testis specific cytochrome c
          Length = 105

 Score =  211 bits (537), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLI YLK+ATNE
Sbjct: 61  SEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIKYLKQATNE 105


Go to top
>sp|P00007|CYC_HIPAM Cytochrome c.
          Length = 105

 Score =  210 bits (535), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/105 (96%), Positives = 104/105 (99%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQ+ GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQSPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK+ATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKQATNE 105


Go to top
>prf|770041A|cytochrome c
          Length = 104

 Score =  210 bits (534), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 104


Go to top
>prf|721933A|cytochrome c
          Length = 104

 Score =  210 bits (534), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 104


Go to top
>prf|660863A|cytochrome c
          Length = 104

 Score =  210 bits (534), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 104


Go to top
>sp|P62896|CYC_SHEEP Cytochrome c.
          Length = 105

 Score =  209 bits (533), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 105


Go to top
>sp|P62895|CYC_PIG Cytochrome c.
          Length = 105

 Score =  209 bits (533), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 105


Go to top
>sp|P62894|CYC_BOVIN Cytochrome c.
          Length = 105

 Score =  209 bits (533), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 105


Go to top
>prf|660913A|cytochrome c
          Length = 104

 Score =  209 bits (533), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 102/104 (98%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKDERADLIAYLKKATNE 104


Go to top
>tr|Q3LUG9|Q3LUG9_CAPHI Mitochondrial cytochrome c (Fragment).
          Length = 104

 Score =  209 bits (533), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 104


Go to top
>sp|P00011|CYC_CANFA Cytochrome c.
          Length = 105

 Score =  207 bits (528), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/105 (96%), Positives = 102/105 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKK GERADLIAYLKKAT E
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE 105


Go to top
>prf|650773A|cytochrome c
          Length = 104

 Score =  207 bits (527), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 102/104 (98%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 104


Go to top
>pdb|2B4Z_A|1.50| 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A           
          Length = 104

 Score =  207 bits (527), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 102/104 (98%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 104


Go to top
>tr|Q3LUG8|Q3LUG8_BUBBU Mitochondrial cytochrome c (Fragment).
          Length = 104

 Score =  207 bits (527), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 102/104 (98%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE 104


Go to top
>sp|P00014|CYC_MACGI Cytochrome c.
          Length = 105

 Score =  207 bits (526), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNL+G+FGRKTGQA GF+YTDANKNKGI W
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGIFGRKTGQAPGFTYTDANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105


Go to top
>sp|P00021|CYC_COLLI Cytochrome c.
          Length = 105

 Score =  205 bits (522), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 101/103 (98%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK+AT
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKQAT 103


Go to top
>sp|P00013|CYC_MINSC Cytochrome c.
          Length = 105

 Score =  205 bits (522), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 100/105 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE TLMEYLENPKKYIPGTKMIFAGIKK  ERADLIAYLKKAT E
Sbjct: 61  GEATLMEYLENPKKYIPGTKMIFAGIKKSAERADLIAYLKKATKE 105


Go to top
>sp|P00020|CYC_ANAPL Cytochrome c.
          Length = 105

 Score =  205 bits (522), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 99/103 (96%), Positives = 100/103 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDAT 103


Go to top
>sp|P68096|CYC_EQUBU Cytochrome c.
          Length = 105

 Score =  205 bits (521), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 105


Go to top
>sp|P68097|CYC_EQUAS Cytochrome c.
          Length = 105

 Score =  205 bits (521), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 105


Go to top
>prf|650776A|cytochrome c
          Length = 104

 Score =  205 bits (521), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 101/104 (97%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKK GERADLIAYLKKAT E
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE 104


Go to top
>sp|P00012|CYC_MIRLE Cytochrome c.
          Length = 105

 Score =  205 bits (521), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TLMEYLENPKKYIPGTKMIFAGIKK GERADLIAYLK AT E
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKIATKE 105


Go to top
>prf|3111412F|mitochondrial cytochrome c somatic
          Length = 105

 Score =  205 bits (521), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGK+IF+QKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF+YT+ANKNKGI W
Sbjct: 1   MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFTYTEANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKKGER DLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE 105


Go to top
>sp|Q52V10|CYC_SAISC Cytochrome c.
          Length = 105

 Score =  205 bits (521), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGK+IF+QKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF+YT+ANKNKGI W
Sbjct: 1   MGDVEKGKRIFIQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFTYTEANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKKGER DLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE 105


Go to top
>sp|P00017|CYC_APTPA Cytochrome c.
          Length = 105

 Score =  204 bits (519), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHG+FGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGIFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDATSK 105


Go to top
>prf|660849A|cytochrome c
          Length = 104

 Score =  204 bits (519), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNL+G+FGRKTGQA GF+YTDANKNKGI WG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGIFGRKTGQAPGFTYTDANKNKGIIWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 104


Go to top
>prf|1002274A|cytochrome c
          Length = 105

 Score =  204 bits (518), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK 105


Go to top
>sp|P67882|CYC_MELGA Cytochrome c.
          Length = 105

 Score =  204 bits (518), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK 105


Go to top
>sp|P67881|CYC_CHICK Cytochrome c.
          Length = 105

 Score =  204 bits (518), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK 105


Go to top
>sp|P00004|CYC_HORSE Cytochrome c.
          Length = 105

 Score =  204 bits (518), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/105 (94%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 105


Go to top
>prf|721949A|cytochrome c
          Length = 104

 Score =  203 bits (516), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 99/104 (95%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E TLMEYLENPKKYIPGTKMIFAGIKK  ERADLIAYLKKAT E
Sbjct: 61  EATLMEYLENPKKYIPGTKMIFAGIKKSAERADLIAYLKKATKE 104


Go to top
>sp|P00018|CYC_DRONO Cytochrome c.
          Length = 105

 Score =  202 bits (515), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 102/105 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNL+GLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDATSK 105


Go to top
>prf|772106A|cytochrome c
          Length = 104

 Score =  202 bits (515), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>sp|P00019|CYC_STRCA Cytochrome c.
          Length = 105

 Score =  202 bits (514), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKGITW
Sbjct: 1   MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLDGLFGRKTGQAEGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDATSK 105


Go to top
>prf|660859A|cytochrome c
          Length = 104

 Score =  201 bits (512), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK AT++
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKSERVDLIAYLKDATSK 104


Go to top
>prf|711086A|cytochrome c
          Length = 104

 Score =  201 bits (512), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTBA+KNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTBABKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>prf|3111412H|mitochondrial cytochrome c somatic
          Length = 105

 Score =  201 bits (512), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGITW
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|Q52V08|CYC_MACSY Cytochrome c.
          Length = 105

 Score =  201 bits (512), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGITW
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|P00002|CYC_MACMU Cytochrome c.
          Length = 105

 Score =  201 bits (512), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGITW
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>prf|610169A|cytochrome c
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|2PCB_B|2.8 | 3| 104|N|YEAST CYTOCHROME C PEROXIDASE (CCP)
           COMPLEX WITH HORSE
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|2GIW|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           NULL; OTHER_D
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|2FRC|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           NULL; OTHER_D
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1WEJ_F|1.8 | 3| 104|N|MOL_ID: 1; MOLECULE: E8 ANTIBODY; CHAIN:
           L, H; FRAGMENT
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1U75_B|2.55| 3| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE; CHAIN: A,
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1OCD|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           NULL; OTHER_D
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1M60_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: ZINC-SUBSTITUTED
           CYTOCHROME C; CHA
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1LC2_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A; SYNONYM: F
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1LC1_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A; SYNONYM: F
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1I5T_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A           
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1HRC|1.9 | 1| 104|N|CYTOCHROME C                             
                       
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1GIW|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           NULL; OTHER_D
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1FI9_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A           
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1FI7_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A           
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1CRC_B|2.08| 2| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1CRC_A|2.08| 2| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>pdb|1AKK|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           NULL        
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GF+YTDANKNKGITW 
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKKATNE
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE 104


Go to top
>prf|721078A|cytochrome c
          Length = 104

 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFV+KCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVEKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TLMEYLENPKKYIPGTKMIFAGIKK GERADLIAYLK AT E
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKIATKE 104


Go to top
>sp|P81280|CYC_ALLMI Cytochrome c.
          Length = 105

 Score =  201 bits (510), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 101/104 (97%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGL GRKTGQA GFSYT+ANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLIGRKTGQAPGFSYTEANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           GE+TLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK+AT+
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKPERADLIAYLKEATS 104


Go to top
>prf|731223A|cytochrome c
          Length = 104

 Score =  200 bits (509), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNL+GLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT++
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDATSK 104


Go to top
>prf|742503A|cytochrome c
          Length = 104

 Score =  200 bits (508), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+EKGKKIFVQKC+QCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 1   GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLDGLFGRKTGQAEGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           EDTLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT+
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKDATS 103


Go to top
>prf|2915403C|cytochrome
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>prf|2915403B|cytochrome
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>prf|1502366A|cytochrome c
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|Q5RFH4|CYC_PONAB Cytochrome c.
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|P99998|CYC_PANTR Cytochrome c.
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|P99999|CYC_HUMAN Cytochrome c.
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|Q6WUX8|CYC_GORGO Cytochrome c.
          Length = 105

 Score =  199 bits (507), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>prf|650775A|cytochrome c
          Length = 104

 Score =  199 bits (505), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 99/104 (95%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGITWG
Sbjct: 1   GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104


Go to top
>sp|Q6DKE1|CYC2_XENLA Cytochrome c, testis-specific.
          Length = 105

 Score =  199 bits (505), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKK+FVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGI W
Sbjct: 1   MGDVEKGKKVFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            EDTLM YLENPKKYIPGTKMIFAGIKKKGER DLIAYLK++T+
Sbjct: 61  DEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTS 104


Go to top
>sp|P00024|CYC_RANCA Cytochrome c.
          Length = 105

 Score =  199 bits (505), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHT EKGGKHK GPNL+GL GRKTGQAAGFSYTDANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTCEKGGKHKVGPNLYGLIGRKTGQAAGFSYTDANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGER DLIAYLK A ++
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKSACSK 105


Go to top
>sp|P00022|CYC_CHESE Cytochrome c.
          Length = 105

 Score =  198 bits (504), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNL+GL GRKTGQA GFSYT+ANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLIGRKTGQAEGFSYTEANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           GE+TLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT+
Sbjct: 61  GEETLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKDATS 104


Go to top
>sp|P00003|CYC_ATESP Cytochrome c.
          Length = 105

 Score =  198 bits (503), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/105 (89%), Positives = 100/105 (95%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDV KGK+IF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA+GF+YT+ANKNKGI W
Sbjct: 1   MGDVFKGKRIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQASGFTYTEANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|Q6IQM2|CYC_DANRE Cytochrome c.
          Length = 104

 Score =  198 bits (503), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 98/104 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKK+FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDVEKGKKVFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK AT+
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS 104


Go to top
>sp|Q640U4|CYC1_XENTR Cytochrome c, somatic.
          Length = 105

 Score =  197 bits (502), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKCAQCHTVEK GKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTL EYLENPKKYIPGTKMIFAGIKKK ERADLIAYLKK+T+E
Sbjct: 61  GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKSTSE 105


Go to top
>prf|630485A|cytochrome c
          Length = 104

 Score =  197 bits (501), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 98/104 (94%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI WG
Sbjct: 1   GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104


Go to top
>pdb|1J3S_A|NOT | 1| 104|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A; SYNONYM: F
          Length = 104

 Score =  197 bits (501), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 98/104 (94%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI WG
Sbjct: 1   GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 104


Go to top
>prf|2915403A|cytochrome
          Length = 105

 Score =  197 bits (500), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 98/105 (93%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKI + KC+QCHTVEKGGKHKTGPN HGLFGRKTGQA G+SYT ANKNKGITW
Sbjct: 1   MGDVEKGKKILIMKCSQCHTVEKGGKHKTGPNHHGLFGRKTGQAPGYSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>sp|Q7YR71|CYC_TRACR Cytochrome c.
          Length = 105

 Score =  197 bits (500), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 98/105 (93%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKI + KC+QCHTVEKGGKHKTGPN HGLFGRKTGQA G+SYT ANKNKGITW
Sbjct: 1   MGDVEKGKKILIMKCSQCHTVEKGGKHKTGPNHHGLFGRKTGQAPGYSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKKK ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 105


Go to top
>prf|660910A|cytochrome c
          Length = 104

 Score =  196 bits (498), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNL+GL GRKTGQA GFSYT+ANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLIGRKTGQAEGFSYTEANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK AT+
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKDATS 103


Go to top
>sp|Q6PBF4|CYC2_XENTR Cytochrome c, testis-specific.
          Length = 105

 Score =  196 bits (497), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 98/104 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD EKGKKIFVQKC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA GFSYTDANKNKGI W
Sbjct: 1   MGDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E TL+EYLENPKKYIPGTKMIFAGIKKKGER DLIAYLK++T+
Sbjct: 61  DEGTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTS 104


Go to top
>sp|P21665|CYC_VARVA Cytochrome c.
          Length = 105

 Score =  194 bits (492), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 97/103 (94%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQKC+QCHTVEKGGKHKTGPNLH LFGRKTG+A GFSYT ANKNKGITW
Sbjct: 1   MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHQLFGRKTGEAEGFSYTAANKNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           GEDTL EYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK+AT
Sbjct: 61  GEDTLFEYLENPKKYIPGTKMIFAGIKKKTERDDLIAYLKEAT 103


Go to top
>sp|P00026|CYC_CYPCA Cytochrome c iso-1/iso-2.
          Length = 104

 Score =  194 bits (492), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKK+FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDVEKGKKVFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK AT+
Sbjct: 61  BEZTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS 104


Go to top
>sp|Q6GQE4|CYC1A_XENLA Cytochrome c, somatic A.
          Length = 105

 Score =  193 bits (490), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/105 (88%), Positives = 97/105 (92%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD EKGKKIF+QKCAQCHTVEK GKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDAEKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTL EYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKK+T+E
Sbjct: 61  GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE 105


Go to top
>prf|1910201A|cytochrome c
          Length = 104

 Score =  193 bits (490), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKCAQCHTVEKGGKHK  PNLHGL GRKTGQA GFSYT+ANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCAQCHTVEKGGKHKGTPNLHGLIGRKTGQAPGFSYTEANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ERADLIAYLK+AT+
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKPERADLIAYLKEATS 103


Go to top
>prf|1011182B|cytochrome c
          Length = 107

 Score =  192 bits (487), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQAAGF+YTDANK+KGITW 
Sbjct: 5   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTDANKSKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK G+RADLIAYLK AT
Sbjct: 65  EDTLFEYLENPKKYIPGTKMIFAGLKKPGDRADLIAYLKSAT 106


Go to top
>pdb|2AIU_A|1.60| 1| 105|N|MOL_ID: 1; MOLECULE: CYTOCHROME C,
           TESTIS-SPECIFIC; CHA
          Length = 105

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/104 (87%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIFVQKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATS 104


Go to top
>tr|A2ARH7|A2ARH7_MOUSE Cytochrome c, testis.
          Length = 105

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/104 (87%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIFVQKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATS 104


Go to top
>sp|P00015|CYC2_MOUSE Cytochrome c, testis-specific.
          Length = 105

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/104 (87%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIFVQKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATS 104


Go to top
>tr|B0XHT8|B0XHT8_CULQU Cytochrome c.
          Length = 108

 Score =  190 bits (483), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 94/102 (92%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+C+QCHTVE GGKHK GPNLHGL GRKTGQAAGFSYTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGLMGRKTGQAAGFSYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK GERADLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPGERADLIAYLKSAT 107


Go to top
>prf|671050A|cytochrome c
          Length = 104

 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 94/101 (93%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQKC+QCHT E GGKHK GPNL+GL GRKTGQAAGFSYTDANKNKGITWG
Sbjct: 1   GDVEKGKKIFVQKCSQCHTCEAGGKHKVGPNLYGLIGRKTGQAAGFSYTDANKNKGITWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           EDTLMEYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK A
Sbjct: 61  EDTLMEYLENPKKYIPGTKMIFAGIKKKQERGDLIAYLKDA 101


Go to top
>tr|A3KEW6|A3KEW6_BRABE Cytochrome c.
          Length = 111

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 99/104 (95%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ +KGKK+FVQKCAQCHTVEKGGKHKTGPNL+GLFGRKTGQA+GFSYTDANKNKGITW 
Sbjct: 8   GNPDKGKKVFVQKCAQCHTVEKGGKHKTGPNLNGLFGRKTGQASGFSYTDANKNKGITWA 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTL  YLENPKKYIPGTKM+FAG+KKKGERADLI+YLK++T+ 
Sbjct: 68  EDTLWVYLENPKKYIPGTKMVFAGLKKKGERADLISYLKESTSS 111


Go to top
>prf|1407207A|testis specific cytochrome c
          Length = 105

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 90/104 (86%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIF+QKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  TEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLKEATS 104


Go to top
>sp|P10715|CYC2_RAT Cytochrome c, testis-specific.
          Length = 105

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 90/104 (86%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIF+QKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  TEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLKEATS 104


Go to top
>prf|754926A|cytochrome c,testis specific
          Length = 104

 Score =  189 bits (480), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 94/103 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GKKIFVQKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKGI W 
Sbjct: 1   GDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGIVWS 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLMEYLENPKKYIPGTKMIFAGIKKK ER DLI YLK+AT+
Sbjct: 61  EETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATS 103


Go to top
>sp|Q6NTN0|CYC1B_XENLA Cytochrome c, somatic B.
          Length = 105

 Score =  189 bits (480), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 91/105 (86%), Positives = 97/105 (92%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD  KGKKIF+QKCAQCHTVEK GKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDAGKGKKIFIQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GE+TL+EYLENPKKYIPGTKMIFAGIKKK ER DLIAYLKK+T+E
Sbjct: 61  GEETLLEYLENPKKYIPGTKMIFAGIKKKNERLDLIAYLKKSTSE 105


Go to top
>sp|P00028|CYC_LAMTR Cytochrome c.
          Length = 105

 Score =  189 bits (479), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 89/105 (84%), Positives = 97/105 (92%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKK+FVQKC+QCHTVEK GKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDVEKGKKVFVQKCSQCHTVEKAGKHKTGPNLSGLFGRKTGQAPGFSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            ++TL  YLENPKKYIPGTKMIFAGIKK+GER DLIAYLKK+T+E
Sbjct: 61  NQETLFVYLENPKKYIPGTKMIFAGIKKEGERKDLIAYLKKSTSE 105


Go to top
>tr|Q1HRI9|Q1HRI9_AEDAE Mitochondrial cytochrome c (Cytochrome c).
          Length = 108

 Score =  189 bits (479), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+C+QCHTVE GGKHK GPNLHG+FGRKTGQAAGFSYTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGIFGRKTGQAAGFSYTDANKAKGITWS 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ERADLIAYLK +T
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERADLIAYLKSST 107


Go to top
>prf|1011182A|cytochrome c
          Length = 107

 Score =  188 bits (478), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQAAGF+YTDANK KGITW 
Sbjct: 5   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTDANKAKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 65  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 106


Go to top
>prf|701200A|cytochrome c
          Length = 103

 Score =  188 bits (478), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQKCAQCHTVZ GGKHK GPNL GLFGRKTGQA GFSYTBA+K+KGI W 
Sbjct: 1   GDVEKGKKVFVQKCAQCHTVZBGGKHKVGPNLWGLFGRKTGQAPGFSYTBABKSKGIVWB 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           Z+TLMEYLZ+PKKYIPGTKMIFAGIKKKGERADLIAYLK AT+
Sbjct: 61  ZZTLMEYLZBPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS 103


Go to top
>tr|Q7PSA9|Q7PSA9_ANOGA AGAP009537-PA.
          Length = 108

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQAAGFSYTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFSYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKM+FAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMVFAGLKKPQERGDLIAYLKSAT 107


Go to top
>tr|Q6PBG3|Q6PBG3_MOUSE Cytochrome c, testis.
          Length = 105

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/104 (86%), Positives = 94/104 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD E GKKIFVQKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYTDANKNKG+ W
Sbjct: 1   MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTK IFAGIKKK ER DLI YLK+AT+
Sbjct: 61  SEETLMEYLENPKKYIPGTKTIFAGIKKKSEREDLIKYLKQATS 104


Go to top
>sp|Q4SG99|CYC_TETNG Cytochrome c.
          Length = 104

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 95/104 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+ KGKK FVQKCAQCHTVE+GGKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W
Sbjct: 1   MGDIAKGKKTFVQKCAQCHTVEEGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            EDTL+EYLENPKKYIPGTKMIFAGIKKK ER DLIAYLK +T+
Sbjct: 61  NEDTLLEYLENPKKYIPGTKMIFAGIKKKAERQDLIAYLKSSTS 104


Go to top
>sp|Q3SZT9|CYC2_BOVIN Cytochrome c 2.
          Length = 105

 Score =  187 bits (476), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 94/104 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           M D E GKKIF+QKCAQCHTVEKGGKHKTGPNL GLFGRKTGQA GFSYT+ANKNKGI W
Sbjct: 1   MADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           GE TLMEYLENPKKYIPGTKMIFAG+KKK ER DLI YLK+AT+
Sbjct: 61  GEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATS 104


Go to top
>sp|P00025|CYC_KATPE Cytochrome c.
          Length = 104

 Score =  187 bits (474), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 94/104 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W
Sbjct: 1   MGDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 104


Go to top
>sp|P12831|CYC_SARPE Cytochrome c.
          Length = 108

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQA GF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAPGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>prf|1211285B|cytochrome c
          Length = 107

 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQA GF+YTDANK KGITW 
Sbjct: 5   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAPGFAYTDANKAKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 65  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 106


Go to top
>prf|731289A|cytochrome c
          Length = 104

 Score =  186 bits (473), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/104 (84%), Positives = 96/104 (92%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQKC+QCHTVEK GKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W 
Sbjct: 1   GDVEKGKKVFVQKCSQCHTVEKAGKHKTGPNLSGLFGRKTGQAPGFSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++TL  YLENPKKYIPGTKMIFAGIKK+GER DLIAYLKK+T+E
Sbjct: 61  QETLFVYLENPKKYIPGTKMIFAGIKKEGERKDLIAYLKKSTSE 104


Go to top
>sp|P00039|CYC_MANSE Cytochrome c.
          Length = 108

 Score =  186 bits (473), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHG FGRKTGQA GFSY+DANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKIGPNLHGFFGRKTGQAPGFSYSDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK+AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMVFAGLKKANERADLIAYLKQAT 107


Go to top
>sp|P00040|CYC_SCHGR Cytochrome c.
          Length = 108

 Score =  186 bits (471), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHKTGPNLHGLFGRKTGQA GFSYTDANK+KGITW 
Sbjct: 6   GDVEKGKKIFVQRCAQCHTVEAGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKSKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKKYIPGTKM+FAG+KK  ERADLIAYLK++T
Sbjct: 66  ENTLFIYLENPKKYIPGTKMVFAGLKKPEERADLIAYLKEST 107


Go to top
>prf|751315A|cytochrome c
          Length = 107

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 5   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 65  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 106


Go to top
>prf|1211285A|cytochrome c
          Length = 107

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 5   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 65  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 106


Go to top
>prf|1105333A|cytochrome c
          Length = 108

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>prf|1103315B|cytochrome c
          Length = 108

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>tr|Q29MT2|Q29MT2_DROPS GA14714-PA (Fragment).
          Length = 108

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>sp|P84029|CYC2_DROME Cytochrome c-2 (Cytochrome c-proximal).
          Length = 108

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>sp|P84030|CYC2_CERCA Cytochrome c-2.
          Length = 108

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHGL GRKTGQAAGF+YTDANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>prf|771301A|cytochrome c
          Length = 107

 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHKTGPNLHGLFGRKTGQA GFSYTDANK+KGITW 
Sbjct: 5   GDVEKGKKIFVQRCAQCHTVEAGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKSKGITWD 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKKYIPGTKM+FAG+KK  ERADLIAYLK++T
Sbjct: 65  ENTLFIYLENPKKYIPGTKMVFAGLKKPEERADLIAYLKEST 106


Go to top
>sp|P00035|CYC_HAEIR Cytochrome c.
          Length = 108

 Score =  185 bits (470), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQAAGF+YT+ANK KGITW 
Sbjct: 6   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTNANKAKGITWQ 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  DDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>sp|P00027|CYC_SQUSU Cytochrome c.
          Length = 105

 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKK+FVQKCAQCHTVE GGKHKTGPNL GLFGRKTGQA GFSYTDANK+KGITW
Sbjct: 1   MGDVEKGKKVFVQKCAQCHTVENGGKHKTGPNLSGLFGRKTGQAQGFSYTDANKSKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            ++TL  YLENPKKYIPGTKMIFAG+KKK ER DLIAYLKK
Sbjct: 61  QQETLRIYLENPKKYIPGTKMIFAGLKKKSERQDLIAYLKK 101


Go to top
>prf|3209367DR|mitochondrial cytochrome c
          Length = 105

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ KGKK FVQKCAQCHTVE+GGKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W 
Sbjct: 3   GDIAKGKKAFVQKCAQCHTVEQGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGIIWS 62

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLM YLENPKKYIPGTKMIFAGIKKK ERADLIAYLK +T+
Sbjct: 63  EETLMVYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKSSTS 105


Go to top
>sp|Q1KKS2|CYCB_FUGRU Cytochrome c-b.
          Length = 105

 Score =  184 bits (468), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ KGKK FVQKCAQCHTVE+GGKHKTGPNL GLFGRKTGQA GFSYTDANK+KGI W 
Sbjct: 3   GDIAKGKKAFVQKCAQCHTVEQGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGIIWS 62

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLM YLENPKKYIPGTKMIFAGIKKK ERADLIAYLK +T+
Sbjct: 63  EETLMVYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKSSTS 105


Go to top
>prf|710246A|cytochrome c
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 93/103 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  ENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1CYC|2.3 | 1| 103|N|FERROCYTOCHROME $C                       
                       
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 93/103 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  ENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>sp|Q6QLW4|CYC_PECGU Cytochrome c.
          Length = 109

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KGKK+FVQ+CAQCHTVE GGKHKTGPNL GLFGRKTGQA GFSYTDANKNKGITWG
Sbjct: 7   GDAAKGKKVFVQRCAQCHTVEAGGKHKTGPNLSGLFGRKTGQAPGFSYTDANKNKGITWG 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL  YLENPKKYIPGTKMIFAG+KKK ERADLIAYL+++T
Sbjct: 67  KDTLWVYLENPKKYIPGTKMIFAGLKKKNERADLIAYLEEST 108


Go to top
>prf|630486A|cytochrome c
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|5CYT_R|1.5 | 1| 103|N|CYTOCHROME $C (REDUCED)                  
                       
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|3CYT_I|1.8 | 2| 103|N|CYTOCHROME $C (OXIDIZED)                 
                       
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|3CYT_O|1.8 | 2| 103|N|CYTOCHROME $C (OXIDIZED)                 
                       
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1LFM_B|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1LFM_A|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1I55_B|2.00| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1I55_A|2.00| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1I54_B|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>pdb|1I54_A|1.50| 2| 103|N|MOL_ID: 1; MOLECULE: CYTOCHROME C; CHAIN:
           A, B        
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>sp|P81459|CYC_THUAA Cytochrome c.
          Length = 103

 Score =  184 bits (467), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 92/103 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV KGKK FVQKCAQCHTVE GGKHK GPNL GLFGRKTGQA G+SYTDANK+KGI W 
Sbjct: 1   GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTLMEYLENPKKYIPGTKMIFAGIKKKGER DL+AYLK AT+
Sbjct: 61  NDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103


Go to top
>sp|P00036|CYC_LUCCU Cytochrome c.
          Length = 108

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQA GF+YT+ANK KGITW 
Sbjct: 6   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAPGFAYTNANKAKGITWQ 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 66  DDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107


Go to top
>prf|0402215A|cytochrome c
          Length = 107

 Score =  183 bits (465), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCHTVE GGKHK GPNLHGLFGRKTGQA GF+YT+ANK KGITW 
Sbjct: 5   GDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAPGFAYTNANKAKGITWQ 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKMIFAG+KK  ER DLIAYLK AT
Sbjct: 65  DDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 106


Go to top
>tr|A7RZ03|A7RZ03_NEMVE Predicted protein.
          Length = 104

 Score =  183 bits (464), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/104 (83%), Positives = 92/104 (88%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD  KG K+F  KCAQCHTVE GGKHKTGPNLHGLFGRKTGQA GFSYT AN+NKGITW
Sbjct: 1   MGDATKGAKVFKTKCAQCHTVEAGGKHKTGPNLHGLFGRKTGQAEGFSYTTANQNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           GEDTLM YLENPKKYIPGTKM+FAGIKKK ER DLIAYLK+ T+
Sbjct: 61  GEDTLMVYLENPKKYIPGTKMVFAGIKKKNERLDLIAYLKQETS 104


Go to top
>prf|1105333B|cytochrome c
          Length = 108

 Score =  183 bits (464), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTVE GGKHK GPNLHG FGRKTGQA GFSY++ANK KGITW 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVEAGGKHKIGPNLHGFFGRKTGQAPGFSYSNANKAKGITWQ 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK+AT
Sbjct: 66  DDTLFEYLENPKKYIPGTKMVFAGLKKANERADLIAYLKQAT 107


Go to top
>sp|P00029|CYC_ASTRU Cytochrome c.
          Length = 104

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/103 (82%), Positives = 94/103 (91%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MG VEKGKKIFVQ+CAQCHTVEK GKHKTGPNL+G+ GRKTGQAAGFSYTDAN+NKGITW
Sbjct: 1   MGQVEKGKKIFVQRCAQCHTVEKAGKHKTGPNLNGILGRKTGQAAGFSYTDANRNKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             +TL EYLENPKKYIPGTKM+FAG+KK+ ER DLIAYL+ AT
Sbjct: 61  KNETLFEYLENPKKYIPGTKMVFAGLKKQKERQDLIAYLEAAT 103


Go to top
>sp|P68519|CYC_CROVV Cytochrome c.
          Length = 105

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 92/103 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF  KC  CHTVE+GGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFSMKCGTCHTVEEGGKHKTGPNLHGLFGRKTGQAVGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           G+DTLMEYLENPKKYIPGTKM+F G+K K ER DLIAYLK+AT
Sbjct: 61  GDDTLMEYLENPKKYIPGTKMVFTGLKSKKERTDLIAYLKEAT 103


Go to top
>sp|P68518|CYC_CROAT Cytochrome c.
          Length = 105

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 92/103 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF  KC  CHTVE+GGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFSMKCGTCHTVEEGGKHKTGPNLHGLFGRKTGQAVGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           G+DTLMEYLENPKKYIPGTKM+F G+K K ER DLIAYLK+AT
Sbjct: 61  GDDTLMEYLENPKKYIPGTKMVFTGLKSKKERTDLIAYLKEAT 103


Go to top
>sp|P68517|CYC_CROAD Cytochrome c.
          Length = 105

 Score =  182 bits (463), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 92/103 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF  KC  CHTVE+GGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI W
Sbjct: 1   MGDVEKGKKIFSMKCGTCHTVEEGGKHKTGPNLHGLFGRKTGQAVGYSYTAANKNKGIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           G+DTLMEYLENPKKYIPGTKM+F G+K K ER DLIAYLK+AT
Sbjct: 61  GDDTLMEYLENPKKYIPGTKMVFTGLKSKKERTDLIAYLKEAT 103


Go to top
>prf|670986A|cytochrome c
          Length = 104

 Score =  182 bits (463), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQKCAQCHTVE GGKHKTGPNL GLFGRKTGQA GFSYTDANK+KGITW 
Sbjct: 1   GDVEKGKKVFVQKCAQCHTVENGGKHKTGPNLSGLFGRKTGQAQGFSYTDANKSKGITWQ 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           ++TL  YLENPKKYIPGTKMIFAG+KKK ER DLIAYLKK
Sbjct: 61  QETLRIYLENPKKYIPGTKMIFAGLKKKSERQDLIAYLKK 100


Go to top
>prf|650737A|cytochrome c
          Length = 104

 Score =  182 bits (463), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIF+ KC+QCHTVEKGGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI WG
Sbjct: 1   GDVEKGKKIFITKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGYSYTAANKNKGIIWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTLMEYLENPKKYIPGTKM+F G+ KK ER +LIAYLK+ T
Sbjct: 61  DDTLMEYLENPKKYIPGTKMVFTGLSKKKERTNLIAYLKEKT 102


Go to top
>tr|B0WTG4|B0WTG4_CULQU Cytochrome c-2.
          Length = 108

 Score =  182 bits (462), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 84/103 (81%), Positives = 91/103 (88%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKK+FVQ+CAQCHTV  GGKH+ GPNLHGL GRKTGQAAG+ YTDANKNKGI W 
Sbjct: 6   GDVEKGKKLFVQRCAQCHTVSAGGKHQVGPNLHGLMGRKTGQAAGYKYTDANKNKGIVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           EDTL EYLENPKKYIPGTKM+F G+KK  ERADLIAYLK AT+
Sbjct: 66  EDTLFEYLENPKKYIPGTKMVFPGMKKPAERADLIAYLKSATS 108


Go to top
>sp|A8MY23|CYCL_HUMAN Putative cytochrome c-like protein
           ENSP00000382267.
          Length = 104

 Score =  182 bits (461), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           + K +++FVQKCAQCHTVEKGGKHKTGPNLHGLFG+KTGQA  F+YTDANKNKGITWGED
Sbjct: 2   LRKARRVFVQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAIVFTYTDANKNKGITWGED 61

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           TLMEYLE+PKKYIP  KMIFAGIKKK ERADL+A LKKATN
Sbjct: 62  TLMEYLESPKKYIPRIKMIFAGIKKKAERADLLACLKKATN 102


Go to top
>tr|A8MV93|A8MV93_HUMAN Uncharacterized protein ENSP00000381989.
          Length = 105

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/105 (84%), Positives = 92/105 (87%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF+ K +QCH VEKGGKHKTGPNLHGLFGRKTGQA G SY    KNK I W
Sbjct: 1   MGDVEKGKKIFIMKRSQCHIVEKGGKHKTGPNLHGLFGRKTGQAPGHSYIATIKNKDIIW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           GEDTLMEYLENPKKYIPGTKMIF GIKK+ ERADLIAYLKKATNE
Sbjct: 61  GEDTLMEYLENPKKYIPGTKMIFVGIKKEEERADLIAYLKKATNE 105


Go to top
>tr|A9NRX3|A9NRX3_PICSI Putative uncharacterized protein.
          Length = 108

 Score =  181 bits (460), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ E GKKIFVQ+CAQCHTVE GGKHK GPNL+G FGRKTGQAAGFSY+DANK KGI+W 
Sbjct: 6   GNAENGKKIFVQRCAQCHTVESGGKHKVGPNLNGFFGRKTGQAAGFSYSDANKAKGISWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK AT
Sbjct: 66  EDTLFEYLENPKKYIPGTKMVFAGLKKPNERADLIAYLKSAT 107


Go to top
>prf|1709162A|cytochrome c
          Length = 104

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIF  KC  CHTVE+GGKHKTGPNLHGLFGRKTGQA G+SYT ANKNKGI WG
Sbjct: 1   GDVEKGKKIFSMKCGTCHTVEEGGKHKTGPNLHGLFGRKTGQAVGYSYTAANKNKGIIWG 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTLMEYLENPKKYIPGTKM+F G+K K ER DLIAYLK+AT
Sbjct: 61  DDTLMEYLENPKKYIPGTKMVFTGLKSKKERTDLIAYLKEAT 102


Go to top
>prf|763065A|cytochrome c
          Length = 103

 Score =  180 bits (457), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G VEKGKKIFVQ+CAQCHTVEK GKHKTGPNL+G+ GRKTGQAAGFSYTDAN+NKGITW 
Sbjct: 1   GQVEKGKKIFVQRCAQCHTVEKAGKHKTGPNLNGILGRKTGQAAGFSYTDANRNKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +TL EYLENPKKYIPGTKM+FAG+KK+ ER DLIAYL+ AT
Sbjct: 61  NETLFEYLENPKKYIPGTKMVFAGLKKQKERQDLIAYLEAAT 102


Go to top
>sp|P00037|CYC_SAMCY Cytochrome c.
          Length = 108

 Score =  179 bits (454), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ E GKKIFVQ+CAQCHTVE GGKHK GPNLHG +GRKTGQA GFSY++ANK KGITWG
Sbjct: 6   GNAENGKKIFVQRCAQCHTVEAGGKHKVGPNLHGFYGRKTGQAPGFSYSNANKAKGITWG 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK++T
Sbjct: 66  DDTLFEYLENPKKYIPGTKMVFAGLKKANERADLIAYLKEST 107


Go to top
>prf|660916A|cytochrome c
          Length = 107

 Score =  179 bits (453), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ E GKKIFVQ+CAQCHTVE GGKHK GPNLHG +GRKTGQA GFSY++ANK KGITWG
Sbjct: 5   GNAENGKKIFVQRCAQCHTVEAGGKHKVGPNLHGFYGRKTGQAPGFSYSNANKAKGITWG 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK++T
Sbjct: 65  DDTLFEYLENPKKYIPGTKMVFAGLKKANERADLIAYLKEST 106


Go to top
>prf|2614268A|cytochrome c
          Length = 105

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 95/105 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW
Sbjct: 1   MGDIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 105


Go to top
>tr|Q9TVZ0|Q9TVZ0_TIGCA Cytochrome c.
          Length = 105

 Score =  178 bits (452), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 95/105 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW
Sbjct: 1   MGDIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 105


Go to top
>tr|Q1ZZQ7|Q1ZZQ7_ACYPI Cytochrome c-like protein.
          Length = 104

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/103 (81%), Positives = 91/103 (88%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDV+KG K+F  KC+QCHTVE GGKHK GPNLHGLFGRKTGQAAG+SYTDANK KGITW
Sbjct: 1   MGDVDKGAKVFQTKCSQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGYSYTDANKQKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            E TL EYLENPKKYIPGTKM+FAGIKK  ER ++IAYLKKAT
Sbjct: 61  NETTLFEYLENPKKYIPGTKMVFAGIKKVEERNNVIAYLKKAT 103


Go to top
>prf|701207A|cytochrome c
          Length = 107

 Score =  178 bits (451), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + GKKIFVQ+CAQCHTVE GGKHK GPNLHG FGRKTGQA GFSY++ANK KGITW 
Sbjct: 5   GNADNGKKIFVQRCAQCHTVEAGGKHKVGPNLHGFFGRKTGQAPGFSYSNANKAKGITWQ 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+KK  ERADLIAYLK+AT
Sbjct: 65  DDTLFEYLENPKKYIPGTKMVFAGLKKANERADLIAYLKQAT 106


Go to top
>tr|Q4PM75|Q4PM75_IXOSC Cytochrome c.
          Length = 109

 Score =  177 bits (449), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIFVQ+CAQCHTVE GGKHKTGPNLHGL GRKTGQAAGFSYTDANK+KGITW 
Sbjct: 7   GDPEKGKKIFVQRCAQCHTVEAGGKHKTGPNLHGLIGRKTGQAAGFSYTDANKSKGITWN 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            DTL  YLE+PKKYIPGTKM+FAG+KK  +R DLIAYL+++T
Sbjct: 67  RDTLFIYLEDPKKYIPGTKMVFAGLKKTQDRGDLIAYLEQST 108


Go to top
>tr|Q9TVZ1|Q9TVZ1_TIGCA Cytochrome c.
          Length = 105

 Score =  177 bits (448), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TG+AAG+SYTDANK+KG+TW
Sbjct: 1   MGDIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGKAAGYSYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 105


Go to top
>tr|Q6B868|Q6B868_9ACAR Cytochrome c.
          Length = 109

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIFVQ+CAQCHTVE GGKHKTGPNLHGL GRKTGQAAGFSYTDAN++KGITW 
Sbjct: 7   GDPEKGKKIFVQRCAQCHTVEAGGKHKTGPNLHGLIGRKTGQAAGFSYTDANRSKGITWN 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            DTL  YLE+PKKYIPGTKM+FAG+KK  +R DLIAYL+++T
Sbjct: 67  RDTLFIYLEDPKKYIPGTKMVFAGLKKTQDRGDLIAYLEQST 108


Go to top
>tr|Q9TZP3|Q9TZP3_TIGCA Cytochrome c.
          Length = 105

 Score =  177 bits (448), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD++KGKKIF QKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW
Sbjct: 1   MGDIDKGKKIFAQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 105


Go to top
>tr|O96573|O96573_TIGCA Cytochrome c.
          Length = 105

 Score =  176 bits (446), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+EKGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TG+AAG+SYTDANK+KG+TW
Sbjct: 1   MGDIEKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGKAAGYSYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG KKKG+R DLIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGPKKKGDREDLIAYLKSASSS 105


Go to top
>sp|P00031|CYC_MACMA Cytochrome c.
          Length = 105

 Score =  176 bits (446), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 92/104 (88%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIFVQ+CAQCH+ +   KHKTGPNL+GLFGR+TGQA+G+ YTDANK KGITW
Sbjct: 1   MGDVEKGKKIFVQRCAQCHSAQANLKHKTGPNLNGLFGRQTGQASGYVYTDANKAKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             DTL  YLENPKKYIPGTKM+FAG+KK  ERADLIAYLK+ATN
Sbjct: 61  QADTLDVYLENPKKYIPGTKMVFAGLKKANERADLIAYLKQATN 104


Go to top
>tr|O96572|O96572_TIGCA Cytochrome c.
          Length = 105

 Score =  175 bits (444), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (89%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW
Sbjct: 1   MGDIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL NPKKYIPGTKM+FAG+KKKG+R  LIAYLK A++ 
Sbjct: 61  NEETLDIYLTNPKKYIPGTKMVFAGLKKKGDREGLIAYLKSASSS 105


Go to top
>sp|P00038|CYC_APIME Cytochrome c.
          Length = 108

 Score =  175 bits (443), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIFVQKCAQCHT+E GGKHK GPNL+G++GRKTGQA G+SYTDANK KGITW 
Sbjct: 6   GDPEKGKKIFVQKCAQCHTIESGGKHKVGPNLYGVYGRKTGQAPGYSYTDANKGKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++TL EYLENPKKYIPGTKM+FAG+KK  ERADLIAY+++A+
Sbjct: 66  KETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYIEQAS 107


Go to top
>prf|1103243A|cytochrome c
          Length = 107

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIFVQKCAQCHT+E GGKHK GPNL+G++GRKTGQA G+SYTDANK KGITW 
Sbjct: 5   GDPEKGKKIFVQKCAQCHTIESGGKHKVGPNLYGVYGRKTGQAPGYSYTDANKGKGITWN 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++TL EYLENPKKYIPGTKM+FAG+KK  ERADLIAY+++A+
Sbjct: 65  KETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYIEQAS 106


Go to top
>tr|Q9TVR1|Q9TVR1_TIGCA Cytochrome c (Fragment).
          Length = 103

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 93/103 (90%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW E
Sbjct: 1   DIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTWNE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  ETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 103


Go to top
>tr|Q4JIM6|Q4JIM6_DERVA Cytochrome C.
          Length = 109

 Score =  174 bits (441), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKK+FVQ+CAQCHTVE GGKHKTGPNLHGL GRKTGQ+ GFSYTDANK+KGITW 
Sbjct: 7   GDPEKGKKVFVQRCAQCHTVEAGGKHKTGPNLHGLIGRKTGQSPGFSYTDANKSKGITWN 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL  YLE+PKKYIPGTKM+FAG+KK  +RADL++YL++AT
Sbjct: 67  KDTLFIYLEDPKKYIPGTKMVFAGLKKVQDRADLMSYLEQAT 108


Go to top
>prf|765949A|cytochrome c
          Length = 104

 Score =  173 bits (439), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/103 (78%), Positives = 91/103 (88%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGKKIFVQ+CAQCH+ +   KHKTGPNL+GLFGR+TGQA+G+ YTDANK KGITW 
Sbjct: 1   GDVEKGKKIFVQRCAQCHSAQANLKHKTGPNLNGLFGRQTGQASGYVYTDANKAKGITWQ 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            DTL  YLENPKKYIPGTKM+FAG+KK  ERADLIAYLK+ATN
Sbjct: 61  ADTLDVYLENPKKYIPGTKMVFAGLKKANERADLIAYLKQATN 103


Go to top
>prf|760259A|cytochrome c
          Length = 108

 Score =  173 bits (439), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGK IF Q+CAQCHTV+KGG HKTGPNLHG+FGR TGQAAGF+YTDANK+KGITW 
Sbjct: 6   GDVEKGKTIFKQRCAQCHTVDKGGPHKTGPNLHGIFGRATGQAAGFAYTDANKSKGITWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+K + +RA+LIAYL++ T
Sbjct: 66  KDTLYEYLENPKKYIPGTKMVFAGLKNEKQRANLIAYLEQET 107


Go to top
>sp|P00030|CYC_EISFO Cytochrome c.
          Length = 108

 Score =  173 bits (439), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVEKGK IF Q+CAQCHTV+KGG HKTGPNLHG+FGR TGQAAGF+YTDANK+KGITW 
Sbjct: 6   GDVEKGKTIFKQRCAQCHTVDKGGPHKTGPNLHGIFGRATGQAAGFAYTDANKSKGITWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM+FAG+K + +RA+LIAYL++ T
Sbjct: 66  KDTLYEYLENPKKYIPGTKMVFAGLKNEKQRANLIAYLEQET 107


Go to top
>tr|Q9TVT6|Q9TVT6_TIGCA Cytochrome c (Fragment).
          Length = 103

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 93/103 (90%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TG+A+G+SYTDANK+KG+TW E
Sbjct: 1   DIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGKASGYSYTDANKSKGVTWNE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK AT+ 
Sbjct: 61  ETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSATSS 103


Go to top
>tr|Q9TVR0|Q9TVR0_TIGCA Cytochrome c (Fragment).
          Length = 103

 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 93/103 (90%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TG+AAG+SYTDANK+KG+TW E
Sbjct: 1   DIDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGKAAGYSYTDANKSKGVTWNE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  ETLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 103


Go to top
>tr|Q9TZP2|Q9TZP2_TIGCA Cytochrome c (Fragment).
          Length = 102

 Score =  172 bits (435), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           ++KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW E+
Sbjct: 1   IDKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTWNEE 60

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           TL  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  TLDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 102


Go to top
>tr|Q1W296|Q1W296_9HEMI Cytochrome c-like protein.
          Length = 108

 Score =  171 bits (433), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 88/102 (86%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKK+FVQKCAQCHTVEKGGKHK GPNL GL G KTGQA GF+YTDAN +KGITW 
Sbjct: 6   GDAEKGKKVFVQKCAQCHTVEKGGKHKVGPNLSGLIGSKTGQAPGFAYTDANISKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL  YLENPKKYIPGTKM+FAGIKK  E  DLIAYL++AT
Sbjct: 66  KDTLFMYLENPKKYIPGTKMVFAGIKKPQESGDLIAYLEQAT 107


Go to top
>tr|Q86EU4|Q86EU4_SCHJA SJCHGC06082 protein.
          Length = 108

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 91/102 (89%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+EKGKK+FVQ+C QCHTVEKGG HKTGPNL+G+FGRKTGQA GF YT ANK+KGITW 
Sbjct: 6   GDIEKGKKLFVQRCGQCHTVEKGGPHKTGPNLNGVFGRKTGQAPGFDYTPANKSKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL EYLENPKK+IPGTKM+FAG+KK  +R D+I+YLK+AT
Sbjct: 66  EQTLFEYLENPKKFIPGTKMVFAGLKKDTDRNDIISYLKEAT 107


Go to top
>tr|A9V8A8|A9V8A8_MONBE Predicted protein.
          Length = 104

 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGDVEKGKKIF + CAQCHTVEKG  HK GPNL+GLFGRKTGQA GF+Y++AN NKGITW
Sbjct: 1   MGDVEKGKKIFQRACAQCHTVEKGAPHKQGPNLNGLFGRKTGQAEGFAYSEANINKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           GEDTL EYL NPKKYIPGTKM+FAG+KKK +R +LIAYLK +
Sbjct: 61  GEDTLFEYLLNPKKYIPGTKMVFAGLKKKSDRENLIAYLKDS 102


Go to top
>tr|Q9TZP1|Q9TZP1_TIGCA Cytochrome c (Fragment).
          Length = 101

 Score =  170 bits (431), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           +KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TGQAAGF+YTDANK+KG+TW E+T
Sbjct: 1   DKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGQAAGFNYTDANKSKGVTWNEET 60

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           L  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK A++ 
Sbjct: 61  LDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSASSS 101


Go to top
>tr|Q9TZP4|Q9TZP4_TIGCA Cytochrome c (Fragment).
          Length = 101

 Score =  169 bits (428), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           +KGKKIFVQKC QCHT+E GGKHK GPNLHG++GR+TG+A+G+SYTDANK+KG+TW E+T
Sbjct: 1   DKGKKIFVQKCTQCHTIEAGGKHKVGPNLHGMYGRQTGKASGYSYTDANKSKGVTWNEET 60

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           L  YL NPKKYIPGTKM+FAG+KKKG+R DLIAYLK AT+ 
Sbjct: 61  LDIYLTNPKKYIPGTKMVFAGLKKKGDREDLIAYLKSATSS 101


Go to top
>tr|A7RP70|A7RP70_NEMVE Predicted protein.
          Length = 109

 Score =  166 bits (420), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG KIF  KC+ CHTVE GGKHKTGPNLHG+FGRKTGQA G++YT AN  KGITW 
Sbjct: 6   GDATKGAKIFKTKCSACHTVEAGGKHKTGPNLHGMFGRKTGQAEGYTYTPANLTKGITWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++TL  YLENPKKYIPGTKM+FAGIKKK ERADLIAYLK+ T  
Sbjct: 66  DETLFVYLENPKKYIPGTKMVFAGIKKKNERADLIAYLKETTTS 109


Go to top
>prf|720617A|cytochrome c
          Length = 104

 Score =  165 bits (418), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ ZKGKKIF QKC QCHTVE GGKHKTGPNL GLFGRK GQA GF+YTDANK KGITW 
Sbjct: 1   GZAZKGKKIFTQKCLQCHTVEAGGKHKTGPNLSGLFGRKQGQAPGFAYTDANKGKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             TL EYLENPKKYIPGTKM+FAG+K + ER  LIAYL++AT
Sbjct: 61  NQTLFEYLENPKKYIPGTKMVFAGLKBZTERVHLIAYLZZAT 102


Go to top
>sp|P00032|CYC_HELAS Cytochrome c.
          Length = 104

 Score =  165 bits (418), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ ZKGKKIF QKC QCHTVE GGKHKTGPNL GLFGRK GQA GF+YTDANK KGITW 
Sbjct: 1   GZAZKGKKIFTQKCLQCHTVEAGGKHKTGPNLSGLFGRKQGQAPGFAYTDANKGKGITWK 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             TL EYLENPKKYIPGTKM+FAG+K + ER  LIAYL++AT
Sbjct: 61  NQTLFEYLENPKKYIPGTKMVFAGLKBZTERVHLIAYLZZAT 102


Go to top
>tr|Q15EU2|Q15EU2_SCHMA Cytochrome c-like protein.
          Length = 108

 Score =  165 bits (417), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 89/102 (87%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+EKGKK+FVQ+C+QCHTVEKGG HK GPNL GLFGRKTGQA G++YT AN +KGI W 
Sbjct: 6   GDIEKGKKLFVQRCSQCHTVEKGGPHKVGPNLSGLFGRKTGQAPGYTYTAANISKGIIWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E +L EYLENPKK+IPGTKM+FAG+KK  +R D+I+YLK+AT
Sbjct: 66  EQSLFEYLENPKKFIPGTKMVFAGLKKDTDRNDIISYLKEAT 107


Go to top
>prf|3209367W|mitochondrial cytochrome c
          Length = 105

 Score =  164 bits (415), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (85%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+ KGKKIFVQ+C+QCHTV K G+HK GPNL GLFGRKTGQA G+SYT AN  KGITW
Sbjct: 1   MGDIAKGKKIFVQRCSQCHTVTKEGRHKVGPNLWGLFGRKTGQAEGYSYTQANIEKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL+NPKKYIPGTKM FAGI+KK ER D+IAY+K+AT++
Sbjct: 61  DEETLNVYLQNPKKYIPGTKMNFAGIRKKRERLDIIAYIKEATSK 105


Go to top
>sp|Q1KL06|CYCA_FUGRU Cytochrome c-a.
          Length = 105

 Score =  164 bits (415), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (85%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           MGD+ KGKKIFVQ+C+QCHTV K G+HK GPNL GLFGRKTGQA G+SYT AN  KGITW
Sbjct: 1   MGDIAKGKKIFVQRCSQCHTVTKEGRHKVGPNLWGLFGRKTGQAEGYSYTQANIEKGITW 60

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E+TL  YL+NPKKYIPGTKM FAGI+KK ER D+IAY+K+AT++
Sbjct: 61  DEETLNVYLQNPKKYIPGTKMNFAGIRKKRERLDIIAYIKEATSK 105


Go to top
>tr|Q29MT1|Q29MT1_DROPS GA12159-PA (Fragment).
          Length = 105

 Score =  160 bits (404), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + GKKIFVQKCAQCHTVE GGKHK GPNL G+ GRK+G A GF YTDAN+ KG+ W 
Sbjct: 4   GDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGVVWS 63

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + TL EYL++PKKYIPGTKM+FAG+KK  +RADLIAYLKK
Sbjct: 64  DSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKK 103


Go to top
>sp|P00046|CYC_SCHPO Cytochrome c.
          Length = 109

 Score =  160 bits (404), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 87/104 (83%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHTVEKGG +K GPNLHG+FGRKTGQA GFSYT+AN++KGITW 
Sbjct: 6   GDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANRDKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TL  YLENPKKYIPGTKM FAG KK  +R ++I YLKKAT+E
Sbjct: 66  EETLFAYLENPKKYIPGTKMAFAGFKKPADRNNVITYLKKATSE 109


Go to top
>prf|0409285A|cytochrome c
          Length = 108

 Score =  159 bits (403), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 87/104 (83%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHTVEKGG +K GPNLHG+FGRKTGQA GFSYT+ANK++GITW 
Sbjct: 5   GDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANKDRGITWB 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           Z+TL  YLENPKKYIPGTKM FAG KK  +R ++I YLKKAT+E
Sbjct: 65  ZZTLFAYLENPKKYIPGTKMAFAGFKKPADRNNVITYLKKATSE 108


Go to top
>prf|710865A|cytochrome c
          Length = 111

 Score =  159 bits (403), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+++ G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKNK +TWG
Sbjct: 9   GNIKSGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVTWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T
Sbjct: 69  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKBST 110


Go to top
>sp|P00072|CYC_FAGES Cytochrome c.
          Length = 111

 Score =  159 bits (403), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+++ G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKNK +TWG
Sbjct: 9   GNIKSGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVTWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T
Sbjct: 69  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKBST 110


Go to top
>tr|A9NKS1|A9NKS1_PICSI Putative uncharacterized protein.
          Length = 113

 Score =  159 bits (401), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCAQCHTV+KG  HK GPNLHGLFGR++G  AG+SY+  NKNK + WG
Sbjct: 10  GDTKVGEKIFKMKCAQCHTVDKGAGHKQGPNLHGLFGRQSGTTAGYSYSAGNKNKAVVWG 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTL EYL NPKKYIPGTKM+F G+KK  ERADLIAYLK+A++ 
Sbjct: 70  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKQASSS 113


Go to top
>tr|A9P208|A9P208_PICSI Putative uncharacterized protein.
          Length = 114

 Score =  159 bits (401), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + WG
Sbjct: 10  GDAKVGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSSANKNKAVNWG 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           EDTL EYL NPKKYIPGTKM+F G+KK  ER DLIAYLKKAT+ 
Sbjct: 70  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQERVDLIAYLKKATSS 113


Go to top
>prf|710737A|cytochrome c
          Length = 113

 Score =  156 bits (394), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCA+CHTVZKG  HK GPNLHGLFGR++G  AG+SY+  NKNK + WG
Sbjct: 9   GDPKAGEKIFKTKCAZCHTVZKGAGHKQGPNLHGLFGRQSGTTAGYSYSTGNKNKAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           Z+TL EYL NPKKYIPGTKM+F G+KK  ZRADLI+YLK+AT++
Sbjct: 69  ZZTLYEYLLNPKKYIPGTKMVFPGLKKPZZRADLISYLKQATSQ 112


Go to top
>sp|P00074|CYC_GINBI Cytochrome c.
          Length = 113

 Score =  156 bits (394), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCA+CHTVZKG  HK GPNLHGLFGR++G  AG+SY+  NKNK + WG
Sbjct: 9   GDPKAGEKIFKTKCAZCHTVZKGAGHKQGPNLHGLFGRQSGTTAGYSYSTGNKNKAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           Z+TL EYL NPKKYIPGTKM+F G+KK  ZRADLI+YLK+AT++
Sbjct: 69  ZZTLYEYLLNPKKYIPGTKMVFPGLKKPZZRADLISYLKQATSQ 112


Go to top
>prf|1513365A|cytochrome c
          Length = 111

 Score =  156 bits (394), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVE GG HK GPNLHGLFGRKTGQ+ G++YTDANK  G+TW 
Sbjct: 9   GDSAKGAKLFQTRCAQCHTVEAGGPHKVGPNLHGLFGRKTGQSEGYAYTDANKQAGVTWD 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKK+IPGTKM F G+KK  ER DLI YLK++T
Sbjct: 69  ENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYLKEST 110


Go to top
>sp|P56205|CYC_ASPNG Cytochrome c.
          Length = 111

 Score =  156 bits (394), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVE GG HK GPNLHGLFGRKTGQ+ G++YTDANK  G+TW 
Sbjct: 9   GDSAKGAKLFQTRCAQCHTVEAGGPHKVGPNLHGLFGRKTGQSEGYAYTDANKQAGVTWD 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKK+IPGTKM F G+KK  ER DLI YLK++T
Sbjct: 69  ENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYLKEST 110


Go to top
>sp|P00047|CYC_THELA Cytochrome c.
          Length = 111

 Score =  155 bits (392), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CAQCH+VE+GG +K GPNLHGLFGRKTG   G+SYTDANK  GITW 
Sbjct: 9   GDASKGANLFKTRCAQCHSVEQGGANKIGPNLHGLFGRKTGSVEGYSYTDANKQAGITWN 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKK+IPGTKM F G+KK  +R DLI YLK+AT
Sbjct: 69  EDTLFEYLENPKKFIPGTKMAFGGLKKNKDRNDLITYLKEAT 110


Go to top
>sp|P00057|CYC_RICCO Cytochrome c.
          Length = 111

 Score =  154 bits (389), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 85/102 (83%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GBV+ G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GBVKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZAT 110


Go to top
>prf|710336A|cytochrome c
          Length = 111

 Score =  154 bits (388), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 85/102 (83%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GBV+ G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GBVKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>tr|A2QC04|A2QC04_ASPNG Cytochrome c cyc-Aspergillus niger.
          Length = 112

 Score =  154 bits (388), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVE GG HK GPNL+GLFGRKTGQA G++YTDANK  G+TW 
Sbjct: 10  GDSAKGAKLFQTRCAQCHTVEAGGPHKVGPNLNGLFGRKTGQAEGYAYTDANKQAGVTWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E++L  YLENPKK+IPGTKM F G+KK  ER DLI YLK++T
Sbjct: 70  ENSLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYLKEST 111


Go to top
>sp|P00061|CYC_SOLTU Cytochrome c.
          Length = 111

 Score =  153 bits (387), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY++ANKN  +TWG
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVDKGAGHKEGPNLNGLFGRQSGTTAGYSYSNANKNMAVTWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEAT 110


Go to top
>prf|1509323A|cytochrome c
          Length = 112

 Score =  153 bits (387), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ +G+KIF  KCAQCH  EKGG HK GPNL GLFGR +G AAGF+Y+ ANK   +TWG
Sbjct: 10  GDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKANKEAAVTWG 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL EYL NPKKY+PG KM+FAG+KK  ERADLIAYLK+AT
Sbjct: 70  ESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAYLKQAT 111


Go to top
>tr|A8J5T0|A8J5T0_CHLRE Mitochondrial cytochrome c.
          Length = 112

 Score =  153 bits (387), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ +G+KIF  KCAQCH  EKGG HK GPNL GLFGR +G AAGF+Y+ ANK   +TWG
Sbjct: 10  GDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKANKEAAVTWG 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL EYL NPKKY+PG KM+FAG+KK  ERADLIAYLK+AT
Sbjct: 70  ESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAYLKQAT 111


Go to top
>sp|P15451|CYC_CHLRE Cytochrome c.
          Length = 112

 Score =  153 bits (387), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ +G+KIF  KCAQCH  EKGG HK GPNL GLFGR +G AAGF+Y+ ANK   +TWG
Sbjct: 10  GDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKANKEAAVTWG 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL EYL NPKKY+PG KM+FAG+KK  ERADLIAYLK+AT
Sbjct: 70  ESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAYLKQAT 111


Go to top
>tr|A1DHL6|A1DHL6_NEOFI Cytochrome c.
          Length = 180

 Score =  152 bits (385), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG K+F  +CAQCHTVE GG HK GPNLHGLFGRKTG A G++YTDANK  G+TW 
Sbjct: 10  GDAKKGAKLFQTRCAQCHTVESGGSHKVGPNLHGLFGRKTGSAEGYAYTDANKQAGVTWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E+TL  YLENPKK+IPGTKM F G+KK  ER DLI Y+
Sbjct: 70  ENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYV 107


Go to top
>sp|P38091|CYC_EMENI Cytochrome c.
          Length = 113

 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +C QCHTVE GG HK GPNLHGLFGRKTGQA G++YTDANK   +TW 
Sbjct: 11  GDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKTGQAGGYAYTDANKQADVTWD 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E++L +YLENPKKYIPGTKM F G+KK  ER DLI YLK++T
Sbjct: 71  ENSLFKYLENPKKYIPGTKMAFGGLKKTKERNDLITYLKEST 112


Go to top
>tr|A2I3V8|A2I3V8_MACHI Cytochrome c-like protein.
          Length = 109

 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ EKGKK+F  KC QCH +E G KHK GP+LHG+ GRKTGQA  FSY+DANK+KGITW 
Sbjct: 6   GNAEKGKKVFETKCRQCHNIEPGSKHKVGPSLHGIMGRKTGQAPNFSYSDANKSKGITWS 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           ++TL EYLENPKKYIPGTKM+FAGIK   ERA+LI ++
Sbjct: 66  KETLFEYLENPKKYIPGTKMVFAGIKSDKERANLIQFI 103


Go to top
>prf|710336B|cytochrome c
          Length = 111

 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GBV+ G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + WG
Sbjct: 9   GBVKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVIWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEAT 110


Go to top
>sp|P00054|CYC_SESIN Cytochrome c.
          Length = 111

 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GBV+ G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + WG
Sbjct: 9   GBVKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVIWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEAT 110


Go to top
>sp|O22642|CYC_FRIAG Cytochrome c.
          Length = 113

 Score =  152 bits (385), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 10  GDFKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVNWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT+ 
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATSS 113


Go to top
>sp|P00060|CYC_SOLLC Cytochrome c.
          Length = 111

 Score =  152 bits (384), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVEKGAGHKEGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEAT 110


Go to top
>prf|741472A|cytochrome c
          Length = 111

 Score =  152 bits (383), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 86/102 (84%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY++ANKN  +TWG
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVDKGAGHKEGPNLNGLFGRQSGTTAGYSYSNANKNMAVTWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>prf|1103315A|cytochrome c
          Length = 105

 Score =  152 bits (383), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 81/99 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GKKIFVQKCAQCHT E GGKHK GPNL G+ GRK G AAG+ YTDAN  KG+TW 
Sbjct: 4   GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWT 63

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L EYL++PKKYIPGTKM+FAG+KK  ERADLIA+LK
Sbjct: 64  EGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102


Go to top
>sp|P04657|CYC1_DROME Cytochrome c-1 (Cytochrome c-distal).
          Length = 105

 Score =  152 bits (383), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 81/99 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GKKIFVQKCAQCHT E GGKHK GPNL G+ GRK G AAG+ YTDAN  KG+TW 
Sbjct: 4   GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWT 63

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L EYL++PKKYIPGTKM+FAG+KK  ERADLIA+LK
Sbjct: 64  EGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102


Go to top
>prf|2010393A|cytochrome c
          Length = 110

 Score =  152 bits (383), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +C QCHTVE GG HK GPNLHGLFGRKTGQA G++YTDANK   +TW 
Sbjct: 8   GDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKTGQAGGYAYTDANKQADVTWD 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E++L +YLENPKKYIPGTKM F G+KK  ER DLI YLK++T
Sbjct: 68  ENSLFKYLENPKKYIPGTKMAFGGLKKTKERNDLITYLKEST 109


Go to top
>tr|A6RAF0|A6RAF0_AJECN Cytochrome c.
          Length = 108

 Score =  152 bits (383), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CAQCHT+E+GG +K GPNLHGLFGRK+GQ  GFSYTDANK+KG+ W 
Sbjct: 6   GDSAKGANLFKTRCAQCHTLEEGGANKIGPNLHGLFGRKSGQVEGFSYTDANKSKGVVWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKKYIPGTKM F G+KK  +R DLI YLK+ T
Sbjct: 66  EETLFAYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLKEET 107


Go to top
>tr|B0D4B4|B0D4B4_LACBS Cytochrome c C1.
          Length = 108

 Score =  152 bits (383), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CAQCHTV  G  +K GPNLHGLFGRK+GQ  GFSYT AN NKG+TW 
Sbjct: 6   GDSAKGASLFKTRCAQCHTVGAGEPNKVGPNLHGLFGRKSGQVEGFSYTAANVNKGVTWE 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM FAG+KK+ +R+DLI YLK++T
Sbjct: 66  EETLFEYLENPKKYIPGTKMAFAGLKKEKDRSDLITYLKEST 107


Go to top
>prf|670964A|cytochrome c
          Length = 112

 Score =  152 bits (383), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G KIF  KCAQCHTV+ G  HK GPNLHGLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNPDAGAKIFKTKCAQCHTVDAGAGHKQGPNLHGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLKKAT+ 
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKKATSS 112


Go to top
>sp|P00068|CYC_WHEAT Cytochrome c.
          Length = 112

 Score =  152 bits (383), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G KIF  KCAQCHTV+ G  HK GPNLHGLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNPDAGAKIFKTKCAQCHTVDAGAGHKQGPNLHGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLKKAT+ 
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKKATSS 112


Go to top
>tr|A4RW27|A4RW27_OSTLU Predicted protein.
          Length = 112

 Score =  152 bits (383), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+  KG KIF  KCAQCH  EKGG HK GPNL GLFGR +G   GFSY+ ANKNKG+TW 
Sbjct: 10  GNAAKGAKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTTEGFSYSAANKNKGVTWS 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+FAG+KK  +RADLIAYLK++T
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFAGLKKPEDRADLIAYLKEST 111


Go to top
>tr|Q9ZSL2|Q9ZSL2_CICIN Cytochrome (Fragment).
          Length = 112

 Score =  151 bits (381), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANK+K +TW 
Sbjct: 10  GNATAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKSKAVTWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKSST 111


Go to top
>prf|720331A|cytochrome c
          Length = 111

 Score =  151 bits (381), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVEKGAGHKEGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQQRADLIAYLKEAT 110


Go to top
>prf|754757A|cytochrome c
          Length = 111

 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCA+CHTVZKG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDAKAGEKIFKTKCAZCHTVZKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVAWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZB+L +YL NPKKYIPGTKM+F G+KK  ZRADLIAYLK +T
Sbjct: 69  ZBSLYDYLLNPKKYIPGTKMVFPGLKKPZZRADLIAYLKAST 110


Go to top
>sp|P00069|CYC_GUIAB Cytochrome c.
          Length = 111

 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCA+CHTVZKG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDAKAGEKIFKTKCAZCHTVZKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVAWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZB+L +YL NPKKYIPGTKM+F G+KK  ZRADLIAYLK +T
Sbjct: 69  ZBSLYDYLLNPKKYIPGTKMVFPGLKKPZZRADLIAYLKAST 110


Go to top
>tr|Q4X0L0|Q4X0L0_ASPFU Cytochrome c.
          Length = 235

 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D +KG K+F  +CAQCHTVE GG HK GPNLHGLFGRKTG A G++YTDANK  G+TW E
Sbjct: 66  DAKKGAKLFQTRCAQCHTVESGGPHKVGPNLHGLFGRKTGSAEGYAYTDANKQAGVTWDE 125

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +TL  YLENPKK+IPGTKM F G+KK  ER DLI Y+
Sbjct: 126 NTLFSYLENPKKFIPGTKMAFGGLKKAKERNDLITYV 162


Go to top
>tr|B0XTA5|B0XTA5_ASPFC Cytochrome c.
          Length = 235

 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D +KG K+F  +CAQCHTVE GG HK GPNLHGLFGRKTG A G++YTDANK  G+TW E
Sbjct: 66  DAKKGAKLFQTRCAQCHTVESGGPHKVGPNLHGLFGRKTGSAEGYAYTDANKQAGVTWDE 125

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +TL  YLENPKK+IPGTKM F G+KK  ER DLI Y+
Sbjct: 126 NTLFSYLENPKKFIPGTKMAFGGLKKAKERNDLITYV 162


Go to top
>sp|Q4HVX7|CYC_GIBZE Cytochrome c.
          Length = 109

 Score =  150 bits (379), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD++KG  +F  +CAQCHTVEK G +K GP LHGL+GRKTG   G+SYTDANK KGI W 
Sbjct: 7   GDIKKGANLFKTRCAQCHTVEKDGGNKIGPALHGLWGRKTGSVEGYSYTDANKQKGIEWN 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLIAYLK +T
Sbjct: 67  DDTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDST 108


Go to top
>prf|730271A|cytochrome c
          Length = 111

 Score =  150 bits (379), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G AAG+SY+ ANKN  + W 
Sbjct: 9   GBZKAGQKIFKLKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTAAGYSYSAANKNMAVVWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZBTL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZBTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>sp|P00058|CYC_GOSBA Cytochrome c.
          Length = 111

 Score =  150 bits (379), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GBAKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZST 110


Go to top
>sp|P00064|CYC_ALLPO Cytochrome c.
          Length = 111

 Score =  150 bits (379), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G AAG+SY+ ANKN  + W 
Sbjct: 9   GBZKAGQKIFKLKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTAAGYSYSAANKNMAVVWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZBTL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZBTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>tr|Q1WLY6|Q1WLY6_CHLIN Mitochondrial apocytochrome c.
          Length = 112

 Score =  150 bits (379), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+ +G+KIF  KCAQCH  EKGG HK GPNL GLFGR +G AAGF+Y+ ANK   +TW 
Sbjct: 10  GDLARGEKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTAAGFAYSKANKEAAVTWS 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL EYL NPKKY+PG KM+FAG+KK  ERADLIA+LK+AT
Sbjct: 70  ESTLYEYLLNPKKYMPGNKMVFAGLKKPEERADLIAFLKQAT 111


Go to top
>tr|Q1DX67|Q1DX67_COCIM Cytochrome c.
          Length = 112

 Score =  150 bits (379), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CAQCHT+EKGG +K GPNLHGLFGRKTGQA GFSYTDANK KGITW 
Sbjct: 9   GDAAKGANLFKTRCAQCHTLEKGGANKVGPNLHGLFGRKTGQAEGFSYTDANKQKGITWD 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            +TL  YLENPKKYIPGTKM F G+KK  +R DLI Y+++
Sbjct: 69  HETLYVYLENPKKYIPGTKMAFGGLKKAKDRNDLITYMEQ 108


Go to top
>tr|A3AYZ5|A3AYZ5_ORYSJ Putative uncharacterized protein.
          Length = 112

 Score =  150 bits (378), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (78%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +G+   GKKIF  KCAQCHTVE+GG HK GPNLHGLFGR++G   G++Y+ ANKN  + W
Sbjct: 9   VGNAASGKKIFRTKCAQCHTVERGGAHKQGPNLHGLFGRQSGTTPGYAYSTANKNMAVVW 68

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            E TL +YL NPKKYIPGTKM+F G+KK  ER DLIAYLK++T
Sbjct: 69  EEGTLYDYLLNPKKYIPGTKMVFPGLKKPQERTDLIAYLKEST 111


Go to top
>sp|P25400|CYC_CANGA Cytochrome c.
          Length = 104

 Score =  150 bits (378), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           +KG  +F  +C QCHTVEKGG +K GPNLHG+FGRK+GQAAG+SYTDAN  K +TW ED 
Sbjct: 4   KKGATLFKTRCLQCHTVEKGGPNKVGPNLHGIFGRKSGQAAGYSYTDANIKKNVTWDEDN 63

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           + +YL NPKKYIPGTKM F G+KK+ +R DLIAYLKKAT++
Sbjct: 64  MSDYLTNPKKYIPGTKMAFGGLKKEKDRKDLIAYLKKATSD 104


Go to top
>sp|P00059|CYC_ABUTH Cytochrome c.
          Length = 111

 Score =  150 bits (378), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G   G+SY+ ANKN  + WG
Sbjct: 9   GBAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZST 110


Go to top
>tr|A9PJI0|A9PJI0_POPJC Putative uncharacterized protein.
          Length = 113

 Score =  149 bits (377), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+K+F  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  +TW 
Sbjct: 10  GDSKVGEKVFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVTWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK++T
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKQST 111


Go to top
>tr|A8QAI4|A8QAI4_MALGO Putative uncharacterized protein.
          Length = 107

 Score =  149 bits (377), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT E+GG +K GPNLHG+FGRK+GQA GFSYT AN NKG+TW 
Sbjct: 6   GDAKKGAGLFKTRCAQCHTTEEGGPNKVGPNLHGIFGRKSGQAEGFSYTAANVNKGVTWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+TL EYLENPKKYIPGTKM F G+KK  +R DLI +L++A
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFNGLKKDKDRNDLITFLREA 106


Go to top
>prf|710866B|cytochrome c
          Length = 111

 Score =  149 bits (376), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 84/102 (82%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GNAKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>prf|700887A|cytochrome c
          Length = 111

 Score =  149 bits (375), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GDPTTGAKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKTST 110


Go to top
>prf|710866A|cytochrome c
          Length = 111

 Score =  149 bits (375), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G   G+SY+ ANKN  + WG
Sbjct: 9   GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>tr|Q0CYF4|Q0CYF4_ASPTN Cytochrome c.
          Length = 131

 Score =  149 bits (375), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVE GG HK GPNL+GLFGRKTGQA G++YTDANK  G+TW 
Sbjct: 10  GDKAKGAKLFQTRCAQCHTVEAGGPHKVGPNLNGLFGRKTGQAEGYAYTDANKQAGVTWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E+TL  YLENPKK+IPGTKM F G+KK  ER DLI Y+
Sbjct: 70  ENTLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYV 107


Go to top
>tr|Q9UVX5|Q9UVX5_FUSOX Cytochrome c549.
          Length = 106

 Score =  148 bits (374), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD++KG  +F  +CAQCHTVEK G +K GP LHGL+GRKTG   G++YTDANK KGI W 
Sbjct: 4   GDIKKGANLFKTRCAQCHTVEKDGGNKIGPALHGLWGRKTGSVEGYAYTDANKQKGIEWN 63

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLIAYLK +T
Sbjct: 64  DDTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDST 105


Go to top
>sp|P53698|CYC_CANAL Cytochrome c.
          Length = 110

 Score =  148 bits (374), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGRK+G A G+SYTDANK KG+ W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFGRKSGLAEGYSYTDANKKKGVEWT 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E T+ +YLENPKKYIPGTKM F G+KK  +R DL+ YLKKAT+
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLKKATS 110


Go to top
>prf|710865B|cytochrome c
          Length = 111

 Score =  148 bits (374), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GBSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>sp|P00056|CYC_MAIZE Cytochrome c.
          Length = 111

 Score =  148 bits (374), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVVWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NP KYIPGTKM+F G+ K  ERADLIAYLK+AT
Sbjct: 69  ENTLYDYLLNPXKYIPGTKMVFPGLXKPQERADLIAYLKEAT 110


Go to top
>sp|P19681|CYC_DEBOC Cytochrome c.
          Length = 110

 Score =  148 bits (374), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +K   +F  +C QCHTVEKGG HK GPNLHG+FGRK+GQAAG+SYTDANK KG+ W 
Sbjct: 8   GSEKKDANLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRKSGQAAGYSYTDANKKKGVEWT 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK  +R DLI YL  AT
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLITYLANAT 109


Go to top
>prf|730272A|cytochrome c
          Length = 111

 Score =  148 bits (373), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G KIF  KCAQCHTV+ G  HK GPNL+GLFGR++G AA +SY+ ANKNK + W 
Sbjct: 9   GNKDVGAKIFKTKCAQCHTVDLGAGHKQGPNLNGLFGRQSGTAASYSYSAANKNKAVIWS 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYL NPKKYIPGTKM+F G+KK  +RADLIAYLK +T
Sbjct: 69  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKDST 110


Go to top
>sp|P00073|CYC_SPIOL Cytochrome c.
          Length = 111

 Score =  148 bits (373), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G KIF  KCAQCHTV+ G  HK GPNL+GLFGR++G AA +SY+ ANKNK + W 
Sbjct: 9   GNKDVGAKIFKTKCAQCHTVDLGAGHKQGPNLNGLFGRQSGTAASYSYSAANKNKAVIWS 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYL NPKKYIPGTKM+F G+KK  +RADLIAYLK +T
Sbjct: 69  EDTLYEYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKDST 110


Go to top
>tr|Q2GVW3|Q2GVW3_CHAGB Cytochrome c.
          Length = 106

 Score =  148 bits (373), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD++KG  +F  +CAQCHTVE+ G +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 4   GDIKKGAGLFKTRCAQCHTVEQDGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 63

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + TL EYLENPKKYIPGTKM F G+KK+ +R DLIAYLK +T
Sbjct: 64  DKTLFEYLENPKKYIPGTKMAFGGLKKEKDRNDLIAYLKDST 105


Go to top
>prf|3201383KTH|ORF
          Length = 112

 Score =  148 bits (373), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVEK G +K GP LHGLFGR+TG   G++YTDANK  G+TW 
Sbjct: 10  GDSAKGAKLFQTRCAQCHTVEKDGANKVGPKLHGLFGRQTGSVDGYAYTDANKQAGVTWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKKYIPGTKM F G+KK  ER DLI YLK++T
Sbjct: 70  ENTLYSYLENPKKYIPGTKMAFGGLKKAKERNDLITYLKEST 111


Go to top
>tr|Q2UFB7|Q2UFB7_ASPOR Cytochrome c.
          Length = 112

 Score =  148 bits (373), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +CAQCHTVEK G +K GP LHGLFGR+TG   G++YTDANK  G+TW 
Sbjct: 10  GDSAKGAKLFQTRCAQCHTVEKDGANKVGPKLHGLFGRQTGSVDGYAYTDANKQAGVTWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL  YLENPKKYIPGTKM F G+KK  ER DLI YLK++T
Sbjct: 70  ENTLYSYLENPKKYIPGTKMAFGGLKKAKERNDLITYLKEST 111


Go to top
>tr|A9P8Y7|A9P8Y7_POPTR Putative uncharacterized protein.
          Length = 113

 Score =  148 bits (373), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+K+F  KC QCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  +TW 
Sbjct: 10  GDSKVGEKVFKTKCTQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVTWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK++T
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKQST 111


Go to top
>tr|A1C6Y9|A1C6Y9_ASPCL Cytochrome c.
          Length = 158

 Score =  147 bits (372), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 77/99 (77%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +GD +KG K+F  +CAQCHTVE GG HK GPNL GLFGRKTG A G++YTDANK  G+TW
Sbjct: 22  IGDAKKGAKLFQTRCAQCHTVEAGGPHKVGPNLSGLFGRKTGSAEGYAYTDANKQAGVTW 81

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            E+TL  YLENPKK+IPGTKM F G+KK  ER DLI  L
Sbjct: 82  DENTLFSYLENPKKFIPGTKMAFGGLKKTKERNDLITSL 120


Go to top
>tr|A9SNF0|A9SNF0_PHYPA Predicted protein.
          Length = 113

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCH VEK   HK GPNLHGLFGR +G  AG++Y+ AN++K + W 
Sbjct: 10  GNEKAGEKIFKTKCAQCHAVEKSAGHKQGPNLHGLFGRTSGTTAGYTYSKANRDKAVDWN 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+ L EYL NPKKYIPGTKM+F G+KK  ERADLIAYLKK+T+E
Sbjct: 70  EEHLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKKSTSE 113


Go to top
>prf|2904232A|cytochrome c
          Length = 108

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD++KG+K+F  +CAQCHT+++G  +K GP LHGLFGRKTG   G++YTDANK KGI W 
Sbjct: 6   GDLKKGEKLFTTRCAQCHTLKEGEGNKVGPALHGLFGRKTGSVEGYAYTDANKQKGIEWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL  YLENPKKYIPGTKM F G+KK  +R DLI+YLKK T
Sbjct: 66  EDTLFTYLENPKKYIPGTKMAFGGLKKDKDRNDLISYLKKET 107


Go to top
>sp|P59218|CYC_ROSNE Cytochrome c.
          Length = 108

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD++KG+K+F  +CAQCHT+++G  +K GP LHGLFGRKTG   G++YTDANK KGI W 
Sbjct: 6   GDLKKGEKLFTTRCAQCHTLKEGEGNKVGPALHGLFGRKTGSVEGYAYTDANKQKGIEWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL  YLENPKKYIPGTKM F G+KK  +R DLI+YLKK T
Sbjct: 66  EDTLFTYLENPKKYIPGTKMAFGGLKKDKDRNDLISYLKKET 107


Go to top
>sp|P00070|CYC_HELAN Cytochrome c.
          Length = 112

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+  NKNK + W 
Sbjct: 10  GNPTTGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAGNKNKAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKTST 111


Go to top
>prf|711058A|cytochrome c
          Length = 111

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>sp|P62773|CYC_BRAOL Cytochrome c.
          Length = 111

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>sp|P62772|CYC_BRANA Cytochrome c.
          Length = 111

 Score =  147 bits (371), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>tr|Q5AZN4|Q5AZN4_EMENI Putative uncharacterized protein.
          Length = 144

 Score =  147 bits (371), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  +C QCHTVE GG HK GPNLHGLFGRKTGQA G++YTDANK   +TW 
Sbjct: 5   GDSTKGAKLFETRCKQCHTVENGGGHKVGPNLHGLFGRKTGQAEGYAYTDANKQADVTWD 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E++L +YLENPKK+IPGTKM F G+KK  ER DLI Y+   T +
Sbjct: 65  ENSLFKYLENPKKFIPGTKMAFGGLKKTKERNDLITYVTLLTTD 108


Go to top
>prf|741670C|cytochrome c
          Length = 111

 Score =  147 bits (370), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDNKAGDKIFKNKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVLWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           Z TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZATLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>prf|2113246A|cytochrome c
          Length = 108

 Score =  147 bits (370), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+E+GG +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 6   GDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R D+I ++K+AT
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEAT 107


Go to top
>prf|1309219A|cytochrome c
          Length = 108

 Score =  147 bits (370), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+E+GG +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 6   GDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R D+I ++K+AT
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEAT 107


Go to top
>sp|P00067|CYC_TROMA Cytochrome c.
          Length = 111

 Score =  147 bits (370), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDNKAGDKIFKNKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVLWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           Z TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZATLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>sp|P00048|CYC_NEUCR Cytochrome c.
          Length = 108

 Score =  147 bits (370), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+E+GG +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 6   GDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R D+I ++K+AT
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEAT 107


Go to top
>tr|A7QC93|A7QC93_VITVI Chromosome undetermined scaffold_77, whole
           genome shotgun sequence.
          Length = 112

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (83%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WGE+TL 
Sbjct: 15  GEKIFRTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVAWGENTLY 74

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 75  DYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 111


Go to top
>prf|741670D|cytochrome c
          Length = 111

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G KIF  KCA+CHTVZ G  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDKDVGGKIFKTKCAZCHTVZLGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVLWA 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +BTL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK AT
Sbjct: 69  BBTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKHAT 110


Go to top
>sp|P00071|CYC_PASSA Cytochrome c.
          Length = 111

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G KIF  KCA+CHTVZ G  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GDKDVGGKIFKTKCAZCHTVZLGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVLWA 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +BTL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK AT
Sbjct: 69  BBTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKHAT 110


Go to top
>tr|A2Q5X9|A2Q5X9_MEDTR Cytochrome c, monohaem.
          Length = 114

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKNK + W 
Sbjct: 10  GNPAAGEKIFRTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNKAVDWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK AT+
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKDATS 112


Go to top
>prf|730986A|cytochrome c
          Length = 111

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB   G+KIF  KCA+CHTV++G  HK GPNLHGLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GBSASGEKIFKTKCAZCHTVBZGAGHKZGPNLHGLFGRQSGTVAGYSYSAANKNKAVNWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  ZRABL+AYLK++T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPZZRABLLAYLKEST 110


Go to top
>sp|P00066|CYC_NIGDA Cytochrome c.
          Length = 111

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB   G+KIF  KCA+CHTV++G  HK GPNLHGLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 9   GBSASGEKIFKTKCAZCHTVBZGAGHKZGPNLHGLFGRQSGTVAGYSYSAANKNKAVNWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  ZRABL+AYLK++T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPZZRABLLAYLKEST 110


Go to top
>prf|741670A|cytochrome c
          Length = 112

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  YNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQST 110


Go to top
>sp|P00063|CYC_ACENE Cytochrome c.
          Length = 112

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + WG
Sbjct: 9   GNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWG 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  YNTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQST 110


Go to top
>prf|701219A|cytochrome c
          Length = 111

 Score =  146 bits (369), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ +KG KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GNSDKGMKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>tr|Q0TY36|Q0TY36_PHANO Putative uncharacterized protein.
          Length = 108

 Score =  146 bits (368), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+++G  +K GPNLHGLFGRKTGQ  G+SYTDANK KGITW 
Sbjct: 6   GDHKKGANLFKTRCAQCHTLKEGEGNKIGPNLHGLFGRKTGQVEGYSYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R DLI +L++ T
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLQEET 107


Go to top
>sp|Q0DI31|CYC_ORYSJ Cytochrome c.
          Length = 112

 Score =  146 bits (368), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + W 
Sbjct: 10  GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLI+YLK+AT+
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS 112


Go to top
>sp|A2Y4S9|CYC_ORYSI Cytochrome c.
          Length = 112

 Score =  146 bits (368), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + W 
Sbjct: 10  GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLI+YLK+AT+
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS 112


Go to top
>prf|3106401AJC|electron carrier
          Length = 111

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  IF  +CAQCHT+  G  HK GPNLHGL GRK+GQA GFSYT AN NKG+TW 
Sbjct: 9   GDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAANVNKGVTWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             TL EYLENPKKYIPGTKM FAG+KK  +R DL+A+L++AT
Sbjct: 69  GQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEAT 110


Go to top
>tr|Q5KNC7|Q5KNC7_CRYNE Electron carrier, putative (Putative
           uncharacterized protein).
          Length = 111

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  IF  +CAQCHT+  G  HK GPNLHGL GRK+GQA GFSYT AN NKG+TW 
Sbjct: 9   GDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAANVNKGVTWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             TL EYLENPKKYIPGTKM FAG+KK  +R DL+A+L++AT
Sbjct: 69  GQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEAT 110


Go to top
>prf|742520A|cytochrome c
          Length = 111

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB  KG KIF  KCA+CHTV+ G  HK GPNL+G FGR +G AAGFSY+ A+K+K   W 
Sbjct: 9   GBPAKGAKIFKAKCAZCHTVBAGAGHKQGPNLNGAFGRTSGTAAGFSYSAABKBKTADWB 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZBTL +YL NPKKYIPGTKM+FAG+KK  +RADLIA+LK AT
Sbjct: 69  ZBTLYDYLLNPKKYIPGTKMVFAGLKKPZBRADLIAFLKDAT 110


Go to top
>sp|P00075|CYC_ENTIN Cytochrome c.
          Length = 111

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB  KG KIF  KCA+CHTV+ G  HK GPNL+G FGR +G AAGFSY+ A+K+K   W 
Sbjct: 9   GBPAKGAKIFKAKCAZCHTVBAGAGHKQGPNLNGAFGRTSGTAAGFSYSAABKBKTADWB 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ZBTL +YL NPKKYIPGTKM+FAG+KK  +RADLIA+LK AT
Sbjct: 69  ZBTLYDYLLNPKKYIPGTKMVFAGLKKPZBRADLIAFLKDAT 110


Go to top
>tr|Q6S4N3|Q6S4N3_HELAN Cytochrome c.
          Length = 112

 Score =  145 bits (367), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+  NKNK + W 
Sbjct: 10  GNPTTGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAGNKNKAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL NPKKYIPGTKM+F G KK  ERADLIAYLK +T
Sbjct: 70  ENTLYDYLLNPKKYIPGTKMVFPGPKKPQERADLIAYLKTST 111


Go to top
>sp|O13393|CYC_PICST Cytochrome c.
          Length = 110

 Score =  145 bits (367), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE+GG HK GPNLHG+ GRK+GQA G+SYTDANK KG+ W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIMGRKSGQAVGYSYTDANKKKGVEWS 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK  +R DL+ YL  AT
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLVTYLASAT 109


Go to top
>tr|A9SRQ9|A9SRQ9_PHYPA Predicted protein.
          Length = 113

 Score =  145 bits (367), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCH VEK   HK GPNLHGLFGR +G   G++Y+ ANK+K + W 
Sbjct: 10  GNDKAGEKIFKTKCAQCHAVEKAAGHKQGPNLHGLFGRTSGTTPGYAYSKANKDKAVEWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E+ L EYL NPKKYIPGTKM+F G+KK  ERADLIAYLKK+T+E
Sbjct: 70  EEKLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKKSTSE 113


Go to top
>sp|P00043|CYC_DEBHA Cytochrome c.
          Length = 110

 Score =  145 bits (367), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE+GG HK GPNLHG+ GR +GQA GFSYTDANK KG+ W 
Sbjct: 8   GSEKKGANLFKTRCLQCHTVEEGGPHKVGPNLHGVVGRTSGQAQGFSYTDANKKKGVEWS 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E  L +YLENPKKYIPGTKM F G+KK  +R DLI+YL KAT
Sbjct: 68  EQNLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLISYLVKAT 109


Go to top
>prf|710864A|cytochrome c
          Length = 111

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN+ + W 
Sbjct: 9   GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNRAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>tr|Q8IM53|Q8IM53_PLAF7 Cytochrome c, putative.
          Length = 115

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (77%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG K+F  KCAQCHT+ KGG  K GPNLHG +GRK+G +  F Y+DANKN GI W 
Sbjct: 13  GDYKKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGDS-DFPYSDANKNSGIIWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L EYL NPK YIPGTKMIFAGIKK+ ERADLI YLKKA++E
Sbjct: 72  DKHLFEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE 115


Go to top
>sp|P00051|CYC_CUCMA Cytochrome c.
          Length = 111

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN+ + W 
Sbjct: 9   GNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNRAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEAT 110


Go to top
>sp|P00052|CYC_PHAAU Cytochrome c.
          Length = 111

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GNSKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 110


Go to top
>sp|O23138|CYC2_ARATH Probable cytochrome c At1g22840.
          Length = 114

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVE G  HK GPNL+GLFGR++G  AG+SY+ ANKNK + W 
Sbjct: 10  GNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E  L +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 70  EKALYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEST 111


Go to top
>tr|Q4PB05|Q4PB05_USTMA CYC_USTSP Cytochrome c.
          Length = 108

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+  G  +K GPNLHGLFGRKTG   GFSYT AN NKG+TW 
Sbjct: 6   GDSKKGAGLFKTRCAQCHTLGAGEPNKVGPNLHGLFGRKTGSVDGFSYTQANINKGVTWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM FAG+KK  +R DLI YL++ T
Sbjct: 66  EETLFEYLENPKKYIPGTKMAFAGLKKDKDRNDLITYLREET 107


Go to top
>tr|A9PHL1|A9PHL1_POPTR Putative uncharacterized protein.
          Length = 113

 Score =  145 bits (365), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+KIF  KCAQCHTV+K   HK GPNL+GLFGR++G   G+SY+ ANKN  + W 
Sbjct: 10  GDSKAGEKIFRTKCAQCHTVDKDAGHKQGPNLNGLFGRQSGTTTGYSYSAANKNMAVMWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  ERADLIAYLK++T
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKQST 111


Go to top
>pdb|2YCC|1.9 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (OXIDIZED)
           (MUTANT WITH CYS 1
          Length = 108

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|2ORL_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C ISO-1;
           CHAIN: A; ENGI
          Length = 108

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|2HV4_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C ISO-1;
           CHAIN: A; ENGI
          Length = 108

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1NMI_A|NOT | 1| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C, ISO-1;
           CHAIN: A; ENG
          Length = 108

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>sp|Q6Q4H8|CYC_PICPA Cytochrome c.
          Length = 110

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE GG HK GPNLHG+FGRK+G A G+SYTDANK KG+ W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRKSGLAEGYSYTDANKRKGVEWS 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK  +R DLI YL  AT
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLASAT 109


Go to top
>sp|P00065|CYC_ARUMA Cytochrome c.
          Length = 111

 Score =  144 bits (364), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NP KYIPGTKM+F G+ K  ERADLIAYLK++T
Sbjct: 69  ESTLYDYLLNPXKYIPGTKMVFPGLXKPQERADLIAYLKEST 110


Go to top
>prf|1309219B|cytochrome c mutant
          Length = 127

 Score =  144 bits (364), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+E+GG +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 6   GDSKKGANLFKTRCAQCHTLEEGGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R D+I Y+ + +
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITYIMRCS 107


Go to top
>pdb|1S6V_D|1.88| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  144 bits (364), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMCFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1S6V_B|1.88| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  144 bits (364), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMCFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CSW|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH LEU 85 R
          Length = 108

 Score =  144 bits (364), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGMKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CCR|1.5 | 1| 111|N|CYTOCHROME $C                            
                       
          Length = 111

 Score =  144 bits (363), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ A+KN  + W 
Sbjct: 9   GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTADKNMAVIWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TL +YL NPKKYIPGTKM+F G+KK  ERADLI+YLK+AT+
Sbjct: 69  ENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS 111


Go to top
>tr|Q4XLY1|Q4XLY1_PLACH Cytochrome c, putative.
          Length = 116

 Score =  144 bits (362), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (78%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG KIF  KCAQCHT+ KGG  K GPNL+G +GRK+G++  F Y+DANKN GI W 
Sbjct: 14  GDYKKGAKIFKAKCAQCHTMNKGGAVKQGPNLYGFYGRKSGES-DFPYSDANKNSGIVWS 72

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L EYL NPK YIPGTKMIFAGIKK+ ERADLI YLKKA++E
Sbjct: 73  DKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE 116


Go to top
>pdb|1CSV|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH LEU 85 R
          Length = 108

 Score =  144 bits (362), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGFKKEKDRNDLITYLKKAT 107


Go to top
>tr|A7PPW4|A7PPW4_VITVI Chromosome chr18 scaffold_24, whole genome
           shotgun sequence (Mitochondrial cytochrome c).
          Length = 112

 Score =  144 bits (362), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + W 
Sbjct: 10  GNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQAT 111


Go to top
>tr|A6S6K1|A6S6K1_BOTFB Cytochrome c.
          Length = 108

 Score =  144 bits (362), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+ +G  +K GPNLHGLFGR+TG   G+SYTDANK K ITW 
Sbjct: 6   GDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRQTGSVEGYSYTDANKQKAITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R DLI +LK+AT
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLIQHLKEAT 107


Go to top
>tr|Q7RDJ2|Q7RDJ2_PLAYO Cytochrome c.
          Length = 116

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (78%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG KIF  KCAQCHT+ KGG  K GPNL+G +GRK+G++  F Y+DANKN GI W 
Sbjct: 14  GDYKKGAKIFKAKCAQCHTMNKGGAVKQGPNLYGFYGRKSGES-DFPYSDANKNSGIIWS 72

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L EYL NPK YIPGTKMIFAGIKK+ ERADLI YLKKA++E
Sbjct: 73  DKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE 116


Go to top
>pdb|2BCN_B|1.70| 3| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE; CHAIN: A,
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA+
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAS 107


Go to top
>pdb|1U74_D|2.40| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE; CHAIN: A,
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA+
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAS 107


Go to top
>pdb|1U74_B|2.40| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE; CHAIN: A,
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA+
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAS 107


Go to top
>prf|710272A|cytochrome c
          Length = 109

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE+GG HK GPNLHG+ GR +GQA GFSYTDANK KG+ W 
Sbjct: 7   GSEKKGANLFKTRCLQCHTVEEGGPHKVGPNLHGVVGRTSGQAQGFSYTDANKKKGVEWT 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E  L +YLENPKKYIPGTKM F G+KK  +R DLI YL KAT
Sbjct: 67  EQDLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLVKAT 108


Go to top
>tr|A8P386|A8P386_COPC7 Putative uncharacterized protein.
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CAQCHT+  G  HK GPNL G+FGRK+G   G+SYT AN NKG+TW 
Sbjct: 6   GDASKGASLFKTRCAQCHTLGNGEPHKVGPNLFGIFGRKSGTGEGYSYTAANINKGVTWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+T+ EYLENPKKYIPGTKM FAG+KK+ +R DL+ YLK+AT+
Sbjct: 66  EETMWEYLENPKKYIPGTKMAFAGLKKEKDRNDLVTYLKEATS 108


Go to top
>pdb|1CHH|1.97| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH PHE 82 R
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM + G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAYGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CHJ|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH LEU 85 R
          Length = 108

 Score =  143 bits (361), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGAKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CSU|1.81| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH LEU 85 R
          Length = 108

 Score =  143 bits (361), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGCKKEKDRNDLITYLKKAT 107


Go to top
>tr|A5K1I5|A5K1I5_PLAVI Cytochrome c, putative.
          Length = 117

 Score =  143 bits (361), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (78%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG K+F  KCAQCHT+ KGG  K GPNL+G +GRK+G++  F Y+DANKN GI W 
Sbjct: 15  GDYKKGAKLFKAKCAQCHTINKGGAVKQGPNLYGFYGRKSGES-DFPYSDANKNSGIIWS 73

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L EYL NPK YIPGTKMIFAGIKK+ ERADLI YLKKA++E
Sbjct: 74  DKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE 117


Go to top
>pdb|1CTZ|1.9 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (REDUCED)
           MUTANT WITH TYR 67
          Length = 108

 Score =  143 bits (360), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + E+L NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEFLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CTY|2.2 | 1| 107|M|CYTOCHROME $C (ISOZYME 1) (OXIDIZED)
           MUTANT WITH TYR 67
          Length = 108

 Score =  143 bits (360), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + E+L NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEFLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>tr|A9RJ09|A9RJ09_PHYPA Predicted protein.
          Length = 113

 Score =  143 bits (360), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 80/103 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCH VEK   HK GPNL+GLFGR +G  AG++Y+ ANK+K + W 
Sbjct: 10  GNEKAGEKIFKTKCAQCHAVEKSAGHKQGPNLNGLFGRTSGTTAGYTYSKANKDKAVVWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+ L EYL NPKKYIPGTKM+F G+KK  ERADLIAYLK +T+
Sbjct: 70  EEQLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKSSTS 112


Go to top
>prf|2115448A|iso-1-cytochrome c
          Length = 109

 Score =  142 bits (359), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 7   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 67  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 107


Go to top
>prf|1409323A|CYC1 locus
          Length = 109

 Score =  142 bits (359), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 7   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 67  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 107


Go to top
>tr|A6ZQ07|A6ZQ07_YEAS7 Iso-1-cytochrome c.
          Length = 109

 Score =  142 bits (359), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 7   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 67  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 107


Go to top
>sp|P00044|CYC1_YEAST Cytochrome c iso-1.
          Length = 109

 Score =  142 bits (359), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 7   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 67  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 107


Go to top
>prf|1715320A|cytochrome c
          Length = 112

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT++ G  +K GP LHGLFGRKTG  AG+SYTDANK KGI W 
Sbjct: 10  GDAKKGANLFKTRCAQCHTLKAGEGNKIGPELHGLFGRKTGSVAGYSYTDANKQKGIEWK 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLI +L++ T
Sbjct: 70  DDTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLEEET 111


Go to top
>sp|P00062|CYC_SAMNI Cytochrome c.
          Length = 111

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 81/102 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KC QCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GNPKAGEKIFKTKCNQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQST 110


Go to top
>sp|P29380|CYC1_ARATH Cytochrome c.
          Length = 112

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT++ G  +K GP LHGLFGRKTG  AG+SYTDANK KGI W 
Sbjct: 10  GDAKKGANLFKTRCAQCHTLKAGEGNKIGPELHGLFGRKTGSVAGYSYTDANKQKGIEWK 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLI +L++ T
Sbjct: 70  DDTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLEEET 111


Go to top
>prf|732192A|cytochrome c
          Length = 111

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCA+CHTV +G  HK GPNL+GLFGR++G  AG+SY+ ANKN  +TW 
Sbjct: 9   GBSKAGEKIFKTKCAECHTVGRGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVTWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           Z TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZKTLYDYLLNPKKYIPGTKMVFPGLKKPZBRADLIAYLKEST 110


Go to top
>sp|P00053|CYC_CANSA Cytochrome c.
          Length = 111

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 82/102 (80%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GB + G+KIF  KCA+CHTV +G  HK GPNL+GLFGR++G  AG+SY+ ANKN  +TW 
Sbjct: 9   GBSKAGEKIFKTKCAECHTVGRGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVTWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           Z TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK++T
Sbjct: 69  ZKTLYDYLLNPKKYIPGTKMVFPGLKKPZBRADLIAYLKEST 110


Go to top
>pdb|2PCC_D|2.3 | 4| 108|N|YEAST CYTOCHROME C PEROXIDASE (CCP)
           COMPLEX WITH YEAST
          Length = 108

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|2PCC_B|2.3 | 4| 108|N|YEAST CYTOCHROME C PEROXIDASE (CCP)
           COMPLEX WITH YEAST
          Length = 108

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|2GB8_B|NOT | 2| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE; CHAIN: A;
          Length = 108

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1YCC|1.23| 1| 107|N|CYTOCHROME C (ISOZYME 1) (REDUCED)       
                       
          Length = 108

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>prf|0602215A|cytochrome c
          Length = 111

 Score =  142 bits (359), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 82/103 (79%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCA+CHTV+KG  HK GP+L GLFGR++G   G+SY+ A+KN  + W 
Sbjct: 9   GNPKAGEKIFKTKCAZCHTVDKGAGHKZGPBLBGLFGRZSGTTPGYSYSTADKNMAVIWZ 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           ZBTL +YL NPKKYIPGTKM+F G+KK  ZRADLI+YLK+AT+
Sbjct: 69  ZBTLYDYLLNPKKYIPGTKMVFPGLKKPZZRADLISYLKEATS 111


Go to top
>pdb|1CSX|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH LEU 94 R
          Length = 108

 Score =  142 bits (358), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R D I YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDSITYLKKAT 107


Go to top
>tr|A5AQD0|A5AQD0_VITVI Putative uncharacterized protein.
          Length = 112

 Score =  142 bits (358), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+   G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR +G   G+SY+ ANKN  + W 
Sbjct: 10  GNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRLSGTTPGYSYSAANKNMAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+AT
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQAT 111


Go to top
>tr|Q4YTB6|Q4YTB6_PLABE Cytochrome c, putative.
          Length = 116

 Score =  142 bits (358), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (78%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG KIF  KCAQCHT+ KGG  K GPNL+G +GRK+G++  F ++DANKN GI W 
Sbjct: 14  GDYKKGAKIFKAKCAQCHTMNKGGAVKQGPNLYGFYGRKSGES-DFPFSDANKNSGIIWS 72

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L EYL NPK YIPGTKMIFAGIKK+ ERADLI YLKKA++E
Sbjct: 73  DKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE 116


Go to top
>pdb|1CHI|2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH PHE 82 R
          Length = 108

 Score =  142 bits (358), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM + G KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAYGGAKKEKDRNDLITYLKKAT 107


Go to top
>prf|741670B|cytochrome c
          Length = 111

 Score =  142 bits (358), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KC QCHTV+KG  HK GPNL+GLFGR++G  AG+SY+ ANKN  + W 
Sbjct: 9   GNPKAGEKIFKTKCNQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWE 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK +T
Sbjct: 69  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNST 110


Go to top
>sp|P00041|CYC_ISSOR Cytochrome c.
          Length = 109

 Score =  142 bits (358), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +CAQCHT+E GG HK GPNLHG+F R +GQA G+SYTDANK  G+ W 
Sbjct: 7   GSAKKGATLFKTRCAQCHTIEAGGPHKVGPNLHGIFSRHSGQAEGYSYTDANKRAGVEWA 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK  +R DL+ Y+ +A+
Sbjct: 67  EPTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLVTYMLEAS 108


Go to top
>sp|Q96VP3|CYC_CURLU Cytochrome c.
          Length = 108

 Score =  142 bits (358), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT++ G  +K GP LHGLFGRKTG  AG+SYTDANK KGI W 
Sbjct: 6   GDAKKGANLFKTRCAQCHTLKAGEGNKIGPELHGLFGRKTGSVAGYSYTDANKQKGIEWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            DTL EYLENPKKYIPGTKM F G+KK  +R DLI +L++ T
Sbjct: 66  HDTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLEQET 107


Go to top
>pdb|1FHB|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: FERRICYTOCHROME C;
           CHAIN: NULL; SY
          Length = 108

 Score =  142 bits (357), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR++GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRQSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTK  F G+KK+ +R DLI YLKKA+
Sbjct: 66  ENNMSEYLTNPKKYIPGTKAAFGGLKKEKDRNDLITYLKKAS 107


Go to top
>prf|2102349A|cytochrome c
          Length = 108

 Score =  142 bits (357), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+ +G  +K GPNLHGLFGR TG   GFSYTDANK KGI W 
Sbjct: 6   GDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRHTGSVEGFSYTDANKAKGIEWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLI +L+ +T
Sbjct: 66  KDTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLITFLQDST 107


Go to top
>sp|Q41346|CYC_STELP Cytochrome c.
          Length = 108

 Score =  142 bits (357), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+ +G  +K GPNLHGLFGR TG   GFSYTDANK KGI W 
Sbjct: 6   GDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRHTGSVEGFSYTDANKAKGIEWN 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +DTL EYLENPKKYIPGTKM F G+KK  +R DLI +L+ +T
Sbjct: 66  KDTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLITFLQDST 107


Go to top
>prf|0709211A|cytochrome c
          Length = 109

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR++G+A G+SYTDAN  K + W 
Sbjct: 7   GSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRQSGKAEGYSYTDANIKKAVEWS 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK+ +R DL+ YL  AT
Sbjct: 67  EQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLANAT 108


Go to top
>sp|P00042|CYC_HANAN Cytochrome c.
          Length = 109

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR++G+A G+SYTDAN  K + W 
Sbjct: 7   GSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRQSGKAEGYSYTDANIKKAVEWS 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK+ +R DL+ YL  AT
Sbjct: 67  EQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLANAT 108


Go to top
>pdb|1YEB|1.95| 1| 108|N|CYTOCHROME C (B-2036 COMPOSITE, REDUCED
           STATE)        
          Length = 108

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 6   GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  EDSMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>tr|A7E6R4|A7E6R4_SCLS1 Cytochrome c.
          Length = 108

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+ +G  +K GPNLHGLFGR+TG   G+SYTDANK K ITW 
Sbjct: 6   GDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRQTGSVEGYSYTDANKQKAITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R DLI +LK+ T
Sbjct: 66  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLIQHLKEET 107


Go to top
>prf|0602232A|cytochrome c iso2
          Length = 113

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 11  GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWD 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 71  EDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKA 111


Go to top
>tr|A6ZQR1|A6ZQR1_YEAS7 Iso-2-cytochrome c.
          Length = 113

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 11  GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWD 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 71  EDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKA 111


Go to top
>sp|P00045|CYC7_YEAST Cytochrome c iso-2.
          Length = 113

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 11  GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWD 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 71  EDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKA 111


Go to top
>tr|Q4RNP2|Q4RNP2_TETNG Chromosome 2 SCAF15010, whole genome
          shotgun sequence. (Fragment).
          Length = 1093

 Score =  141 bits (356), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/76 (82%), Positives = 67/76 (88%)

Query: 2  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
          GD+EKGKK FVQKCAQCHTVE+GGKHKTGPNL GL GRKTGQA GFSYTDANK+KGI W 
Sbjct: 3  GDMEKGKKTFVQKCAQCHTVEQGGKHKTGPNLWGLLGRKTGQAEGFSYTDANKSKGIIWS 62

Query: 62 EDTLMEYLENPKKYIP 77
          E+TLM YLENPKK  P
Sbjct: 63 EETLMVYLENPKKGEP 78


Go to top
>sp|Q9T0G2|CYC3_ARATH Probable cytochrome c At4g10040.
          Length = 112

 Score =  141 bits (356), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTVEKG  HK GPNL+GLFGR++G   G+SY+ ANK+  + W 
Sbjct: 10  GNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YL NPKKYIPGTKM+F G+KK  +RADLIAYLK+ T
Sbjct: 70  EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGT 111


Go to top
>pdb|1YEA|1.9 | 1| 112|N|CYTOCHROME C (ISO-2, REDUCED STATE)      
                       
          Length = 112

 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 10  GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 70  EDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKA 110


Go to top
>pdb|1LMS_A|NOT | 1| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C, ISO-1;
           CHAIN: A; ENG
          Length = 108

 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 76/102 (74%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NP KYIPGT M F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPAKYIPGTAMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|2B12_B|3.02| 2| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM + G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAYGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1CRG|2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (OXIDIZED)
           MUTANT WITH ASN 52
          Length = 108

 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>prf|721942A|cytochrome c iso2
          Length = 112

 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE+GG +K GPNLHG+FGR +GQ  G+SYTDAN NK + W 
Sbjct: 10  GSAKKGATLFKTRCQQCHTVEEGGPNKVGPNLHGIFGRHSGQVVGYSYTDANINKNVKWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NP KYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 70  EDSMSEYLTNPXKYIPGTKMAFAGLKKEKDRNDLITYMTKA 110


Go to top
>sp|Q4N594|CYC_THEPA Cytochrome c.
          Length = 115

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 83/104 (79%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  KCAQCHT+ KGG  K GPNL+G +GRK+G A+ ++Y+DANKN GI W 
Sbjct: 13  GDSSKGAKLFKSKCAQCHTINKGGSVKQGPNLYGFYGRKSG-ASDYAYSDANKNSGIVWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L  YL NPK+YIPGTKM+FAG+KK+ +RADLIAYLK+A+++
Sbjct: 72  DKHLFVYLVNPKQYIPGTKMVFAGLKKEQDRADLIAYLKEASSK 115


Go to top
>prf|681080A|cytochrome c
          Length = 109

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +CA+CHT+E GG HK GPNLHG+F R +GQA G+SYTDANK  G+ W 
Sbjct: 7   GSAKKGATLFKTRCAECHTIEAGGPHKVGPNLHGIFSRHSGQAEGYSYTDANKRAGVEWA 66

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E T+ +YLENPKKYIPGTKM F G+KK  +R DL+ Y+ +A+
Sbjct: 67  EPTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLVTYMLEAS 108


Go to top
>prf|721941A|cytochrome cA
          Length = 111

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 74/102 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG  +F  +CA+CH        K GPNLHGLFGRKTG   G+SYTDANK  GITW 
Sbjct: 9   GDASKGANLFKTRCAECHGEGANVSQKIGPNLHGLFGRKTGSVEGYSYTDANKQAGITWN 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDTL EYLENPKK+IPGTKM F G+KK  +R DLI YLK+AT
Sbjct: 69  EDTLFEYLENPKKFIPGTKMAFGGLKKNKDRNDLITYLKEAT 110


Go to top
>prf|721254A|cytochrome c
          Length = 107

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG +IF  +CAQCHT+  G  +K GPNLHGLFGRK+G   GFSYTDANK  G  W 
Sbjct: 5   GDAKKGARIFKTRCAQCHTLGAGEPNKVGPNLHGLFGRKSGTVEGFSYTDANKKAGQVWE 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+T +EYLENPKKYIPGTKM F G+KK+ +R DL+ YL++ T
Sbjct: 65  EETFLEYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLREET 106


Go to top
>tr|B2B0B7|B2B0B7_PODAN Predicted CDS Pa_3_8590.
          Length = 108

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CAQCHT+E GG +K GP LHGLFGRK+G   G++YTDANK KG+ W 
Sbjct: 6   GDSKKGANLFKTRCAQCHTLEAGGGNKIGPALHGLFGRKSGTVEGYAYTDANKQKGVVWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + TL +YLENPKKYIPGTKM F G+KK  +R DLI +LK++T
Sbjct: 66  DQTLFDYLENPKKYIPGTKMAFGGLKKDKDRNDLITFLKEST 107


Go to top
>tr|A5DYC1|A5DYC1_LODEL Cytochrome c.
          Length = 110

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 79/103 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT EKGG +K GPNLHG+FGR +GQA G+SYT+ANK  G+ W 
Sbjct: 8   GSSKKGATLFKTRCLQCHTTEKGGANKVGPNLHGVFGRHSGQAEGYSYTEANKKAGVLWD 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E  + +YLENPKKYIPGTKM FAG+KK  +R DL+ YLK+AT+
Sbjct: 68  EQHMSDYLENPKKYIPGTKMAFAGLKKAKDRNDLVTYLKEATS 110


Go to top
>sp|P00049|CYC_USTSP Cytochrome c.
          Length = 107

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 78/102 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG +IF  +CAQCHT+  G  +K GPNLHGLFGRK+G   GFSYTDANK  G  W 
Sbjct: 5   GDAKKGARIFKTRCAQCHTLGAGEPNKVGPNLHGLFGRKSGTVEGFSYTDANKKAGQVWE 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+T +EYLENPKKYIPGTKM F G+KK+ +R DL+ YL++ T
Sbjct: 65  EETFLEYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLREET 106


Go to top
>pdb|2B11_D|2.30| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM + G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAWGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|2B11_B|2.30| 4| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM + G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAWGGLKKEKDRNDLITYLKKA 106


Go to top
>tr|A7ANI1|A7ANI1_BABBO Cytochrome c, putative.
          Length = 115

 Score =  140 bits (353), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 81/102 (79%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG K+F  KCAQCHT  KGG  K GPNL+GLFGR +G +A ++YTDANK+ GI W 
Sbjct: 13  GDAQKGAKLFKSKCAQCHTTNKGGATKQGPNLYGLFGRASG-SADYAYTDANKSSGIVWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +  L  YL NPK+YIPGTKMIFAG+KK+ +RAD+IAYLK+AT
Sbjct: 72  DKHLFVYLVNPKEYIPGTKMIFAGLKKEQDRADIIAYLKEAT 113


Go to top
>pdb|2B0Z_B|2.70| 2| 108|M|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  140 bits (353), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAIGGLKKEKDRNDLITYLKKA 106


Go to top
>tr|A4R2C5|A4R2C5_MAGGR Cytochrome c.
          Length = 108

 Score =  140 bits (352), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G K+F  +C QCHTV+  G +K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 6   GNAKNGAKLFKTRCEQCHTVDAAGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YLENPKKYIPGTKM F G+KK+ +R DLI +LK+ T
Sbjct: 66  ENTLFDYLENPKKYIPGTKMAFGGLKKEKDRNDLITFLKENT 107


Go to top
>prf|690947A|cytochrome c
          Length = 108

 Score =  140 bits (352), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C  CHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCELCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1CRJ|2.05| 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ASN 52 R
          Length = 108

 Score =  139 bits (351), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + E+L NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEFLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>pdb|1CRI|2.0 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (OXIDIZED)
           MUTANT WITH ASN 52
          Length = 108

 Score =  139 bits (351), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 77/102 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+ + E+L NPKKYIPGTKM F G+KK+ +R DLI YLKKAT
Sbjct: 66  ENNMSEFLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKAT 107


Go to top
>tr|A7TN23|A7TN23_VANPO Putative uncharacterized protein.
          Length = 108

 Score =  139 bits (351), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE GG +K GPNLHG+FGR+TG AAG+SYTDAN  KGI W 
Sbjct: 6   GSEKKGATLFKTRCLQCHTVEAGGPNKVGPNLHGVFGRQTGSAAGYSYTDANIKKGIVWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + +YL NPKKYIPGTKM F G+KK+ +R DLIAYL KA
Sbjct: 66  ENNMSDYLINPKKYIPGTKMAFGGLKKEKDRNDLIAYLVKA 106


Go to top
>pdb|2B10_D|2.80| 4| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  139 bits (351), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMASGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|2B10_B|2.80| 4| 108|N|MOL_ID: 1; MOLECULE: CYTOCHROME C
           PEROXIDASE, MITOCHOND
          Length = 108

 Score =  139 bits (351), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMASGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1CRH|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ASN 52 R
          Length = 108

 Score =  139 bits (350), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>tr|A5DJV7|A5DJV7_PICGU Cytochrome c.
          Length = 110

 Score =  138 bits (348), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 75/102 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE+G  +K GPNLHGL GRK+GQ  G+SYTDANK KG+ W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEEGAPNKVGPNLHGLIGRKSGQVEGYSYTDANKKKGVEWT 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E  L +YLENPKKYIPGTKM F G+KK  +R DLI YL  AT
Sbjct: 68  EQNLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLVSAT 109


Go to top
>tr|Q5EMY9|Q5EMY9_MAGGR Cytochrome c-like protein.
          Length = 217

 Score =  138 bits (348), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           + + G K+F  +C QCHTV+  G +K GP LHGLFGRKTG   G++YTDANK KGITW E
Sbjct: 116 NAKNGAKLFKTRCEQCHTVDAAGGNKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWDE 175

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +TL +YLENPKKYIPGTKM F G+KK+ +R DLI +LK+ T
Sbjct: 176 NTLFDYLENPKKYIPGTKMAFGGLKKEKDRNDLITFLKENT 216


Go to top
>tr|Q8GU28|Q8GU28_9CHLO Cytochrome c.
          Length = 112

 Score =  138 bits (348), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 79/102 (77%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G++  G+KIF  KCAQCH  E GG HK GPNL GLFGR +G AAGF+++ ANK   +TW 
Sbjct: 10  GNIANGEKIFKTKCAQCHVAENGGGHKQGPNLGGLFGRVSGTAAGFAFSKANKEAAVTWS 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E +L +YL NPKK++PG KM+FAG+KK  +RADLIA+LK+A+
Sbjct: 70  EHSLYDYLLNPKKFMPGNKMVFAGLKKPEDRADLIAFLKQAS 111


Go to top
>tr|A9V8B2|A9V8B2_MONBE Predicted protein.
          Length = 118

 Score =  138 bits (348), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (74%), Gaps = 3/106 (2%)

Query: 1   MGDVE---KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG 57
           M DVE   +GKK+F+QKCA CH       HK+GPNL GLFGR+TGQA  + YTDAN++KG
Sbjct: 1   MADVEALRRGKKLFIQKCAMCHATHPQAPHKSGPNLAGLFGRQTGQAPNYPYTDANRSKG 60

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ITW   TL  YL +P+KYIPGTKM + G+K  G+R DLIA+L+KAT
Sbjct: 61  ITWTRATLDTYLIDPRKYIPGTKMNYPGLKDAGQRQDLIAFLEKAT 106


Go to top
>pdb|1RAQ|1.9 | 1| 108|M|REP A2 ISO-1-CYTOCHROME C (REDUCED STATE)
           MUTANT WITH G
          Length = 108

 Score =  138 bits (347), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTV++GG +K GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVDQGGANKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1YTC|1.8 | 1| 112|M|MOL_ID: 1; MOLECULE: YEAST ISO-2
           CYTOCHROME C; CHAIN: N
          Length = 112

 Score =  137 bits (346), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT+E+GG +K GPNLHG+FGR +GQ  G+SYTDA  NK + W 
Sbjct: 10  GSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDAIINKNVKWD 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           ED++ EYL NPKKYIPGTKM FAG+KK+ +R DLI Y+ KA
Sbjct: 70  EDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKA 110


Go to top
>pdb|1CIF|1.9 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ARG 38 R
          Length = 108

 Score =  137 bits (344), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FG  +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGAHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMASGGLKKEKDRNDLITYLKKA 106


Go to top
>sp|Q4UEA0|CYC_THEAN Cytochrome c.
          Length = 115

 Score =  137 bits (344), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 81/104 (77%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG K+F  KCAQCHT+ KGG  K GPNL G +GRK+G +  ++Y+DANKN GI W 
Sbjct: 13  GDPAKGAKLFKSKCAQCHTINKGGSVKQGPNLFGFYGRKSG-STDYAYSDANKNSGIVWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +  L  YL NPK+YIPGTKM+FAG+KK+ +RADLIAYLK+A+++
Sbjct: 72  DKHLFVYLVNPKQYIPGTKMVFAGLKKEQDRADLIAYLKEASSK 115


Go to top
>sp|O93863|CYC_PACTA Cytochrome c.
          Length = 110

 Score =  137 bits (344), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 74/102 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT E GG HK GPNL+G+FGR +GQA G+SYTDANK KG  W 
Sbjct: 8   GSAKKGATLFKTRCLQCHTTEAGGAHKVGPNLNGVFGRHSGQAEGYSYTDANKQKGALWE 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             T+ +YLENPKKYIPGTKM F G+KK  +R DL+ YL  AT
Sbjct: 68  AQTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLVTYLLSAT 109


Go to top
>prf|2214401B|cytochrome c
          Length = 111

 Score =  136 bits (343), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F Q+C QCH V+     KTGP LHG+ GRK+G   GF Y+ ANKNKG+ W 
Sbjct: 6   GDYERGKKVFKQRCLQCHVVDSKAT-KTGPTLHGIIGRKSGAVPGFDYSTANKNKGVVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            +TL EYL NPKKYIPGTKM+FAG+KK  ERADLI Y+++
Sbjct: 65  RETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEE 104


Go to top
>prf|3024408ADX|AFR360Wp protein
          Length = 155

 Score =  136 bits (343), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT EKGG HK GPNLHG+F R++GQ +G+SYTDA  N+ +TW 
Sbjct: 53  GSEKKGATLFKTRCLQCHTTEKGGPHKVGPNLHGVFSRQSGQVSGYSYTDAMINRNVTWD 112

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
             ++ +YLENPKKYIPGTKM F G+KK+ +R DLI Y+ KA
Sbjct: 113 AQSMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLITYMLKA 153


Go to top
>pdb|1CIG|1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ARG 38 R
          Length = 108

 Score =  136 bits (343), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FG  +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGAHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>pdb|1CIE|1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ASN 52 R
          Length = 108

 Score =  136 bits (343), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FGR +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMASGGLKKEKDRNDLITYLKKA 106


Go to top
>prf|1915382A|cytochrome c
          Length = 110

 Score =  136 bits (342), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE GG HK GPNLHG+FGR +G+A+G+SYTDAN  K + W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRHSGKASGYSYTDANIKKNVLWD 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E T+ +YLENPKKYIPGTKM F G+KK+ +R D++ Y+ KA
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDIVTYMLKA 108


Go to top
>sp|P32556|CYC_KLULA Cytochrome c.
          Length = 110

 Score =  136 bits (342), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVE GG HK GPNLHG+FGR +G+A+G+SYTDAN  K + W 
Sbjct: 8   GSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRHSGKASGYSYTDANIKKNVLWD 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E T+ +YLENPKKYIPGTKM F G+KK+ +R D++ Y+ KA
Sbjct: 68  EQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDIVTYMLKA 108


Go to top
>pdb|1RAP|2.25| 1| 108|M|REP A2 ISO-1-CYTOCHROME C (REDUCED STATE)
           MUTANT WITH G
          Length = 108

 Score =  136 bits (342), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT ++GG +K GPNLHG+FGR +GQA G+SYTDAN  K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTFDQGGANKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM F G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKA 106


Go to top
>sp|P92504|CYC1_ASCSU Cytochrome c type-1.
          Length = 112

 Score =  135 bits (341), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GKK+F Q+C QCH V+     KTGP LHG+ GRK+G   GF Y+ ANKNKG+ W 
Sbjct: 7   GDYESGKKVFKQRCLQCHVVDSKAT-KTGPTLHGIIGRKSGAVPGFDYSTANKNKGVVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            +TL EYL NPKKYIPGTKM+FAG+KK  ERADLI Y+++
Sbjct: 66  RETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIEE 105


Go to top
>sp|P19974|CYC_CAEEL Cytochrome c.
          Length = 111

 Score =  135 bits (341), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/99 (61%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKK++ Q+C QCH V+     KTGP LHG+ GR +G  +GF Y+ ANKNKG+ W 
Sbjct: 7   GDYEKGKKVYKQRCLQCHVVDSTAT-KTGPTLHGVIGRTSGTVSGFDYSAANKNKGVVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           ++TL EYL NPKKYIPGTKM+FAG+KK  ERADLI Y++
Sbjct: 66  KETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIE 104


Go to top
>prf|1702154A|cytochrome c
          Length = 110

 Score =  135 bits (341), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 61/99 (61%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKK++ Q+C QCH V+     KTGP LHG+ GR +G  +GF Y+ ANKNKG+ W 
Sbjct: 6   GDYEKGKKVYKQRCLQCHVVDSTAT-KTGPTLHGVIGRTSGTVSGFDYSAANKNKGVVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           ++TL EYL NPKKYIPGTKM+FAG+KK  ERADLI Y++
Sbjct: 65  KETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIE 103


Go to top
>sp|Q753F4|CYC_ASHGO Cytochrome c.
          Length = 110

 Score =  135 bits (340), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHT EKGG HK GPNLHG+F R++GQ +G+SYTDA  N+ +TW 
Sbjct: 8   GSEKKGATLFKTRCLQCHTTEKGGPHKVGPNLHGVFSRQSGQVSGYSYTDAMINRNVTWD 67

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
             ++ +YLENPKKYIPGTKM F G+KK+ +R DLI Y+ KA
Sbjct: 68  AQSMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLITYMLKA 108


Go to top
>tr|A9SLT5|A9SLT5_PHYPA Predicted protein.
          Length = 111

 Score =  135 bits (340), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCH +     HK GPNL GLFGR +G AAG+SY+ ANK K + W 
Sbjct: 10  GNGKAGEKIFKTKCAQCHGIAASEGHKQGPNLQGLFGRTSGTAAGYSYSAANKTKAVKWN 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E +L EYL NPKKYIPGTKM+F G+KK  +RADLIAYLK A+
Sbjct: 70  ETSLYEYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKSAS 111


Go to top
>tr|A8X769|A8X769_CAEBR CBR-CYC-2.2 protein.
          Length = 129

 Score =  134 bits (337), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/99 (62%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIF Q+C QCH V    + KTGP L+G+ GR++GQ AGF Y+ ANKNKG+ W 
Sbjct: 17  GDYEKGKKIFKQRCEQCHVVN-SLQTKTGPTLNGVIGRQSGQVAGFDYSAANKNKGVVWD 75

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             TL EYL +PKKYIPGTKM+FAG+KK  ERADLI +++
Sbjct: 76  RQTLFEYLADPKKYIPGTKMVFAGLKKADERADLIKFIE 114


Go to top
>pdb|1CIH|1.8 | 1| 108|M|CYTOCHROME C (ISOZYME 1) (REDUCED) MUTANT
           WITH ARG 38 R
          Length = 108

 Score =  133 bits (335), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +C QCHTVEKGG HK GPNLHG+FG  +GQA G+SYTDA   K + W 
Sbjct: 6   GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGAHSGQAEGYSYTDAIIKKNVLWD 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E+ + EYL NPKKYIPGTKM   G+KK+ +R DLI YLKKA
Sbjct: 66  ENNMSEYLTNPKKYIPGTKMASGGLKKEKDRNDLITYLKKA 106


Go to top
>sp|Q23240|CYC2_CAEEL Probable cytochrome c.
          Length = 123

 Score =  133 bits (334), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 61/99 (61%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKKIF Q+C QCH V    + KTGP L+G+ GR++GQ AGF Y+ ANKNKG+ W 
Sbjct: 17  GDNEKGKKIFKQRCEQCHVVN-SLQTKTGPTLNGVIGRQSGQVAGFDYSAANKNKGVVWD 75

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             TL +YL +PKKYIPGTKM+FAG+KK  ERADLI +++
Sbjct: 76  RQTLFDYLADPKKYIPGTKMVFAGLKKADERADLIKFIE 114


Go to top
>tr|A8WQY3|A8WQY3_CAEBR CBR-CYC-2.1 protein.
          Length = 112

 Score =  132 bits (333), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 60/99 (60%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD EKGKK++ Q+C QCH V+     KTGP L+G+ GR +G  AGF Y+ ANK+KG+ W 
Sbjct: 7   GDYEKGKKVYKQRCLQCHVVDSTAT-KTGPTLYGVIGRTSGTVAGFDYSAANKSKGVVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +TL EYL NPKKYIPGTKM+FAG+KK  ERADLI Y++
Sbjct: 66  RETLFEYLLNPKKYIPGTKMVFAGLKKADERADLIKYIE 104


Go to top
>sp|Q6C9Q0|CYC_YARLI Cytochrome c.
          Length = 107

 Score =  132 bits (332), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  +KG  +F  +CAQCHT E GG HK GPNLHG+  R +G+A G+SY+DANK KGI W 
Sbjct: 6   GSAKKGATLFKTRCAQCHTTEAGGPHKVGPNLHGVINRHSGEAEGYSYSDANKRKGIEWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L EYLENPKKYIPGTKM F G+KK  +R DLI ++
Sbjct: 66  TEHLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITWM 103


Go to top
>prf|660860A|cytochrome c
          Length = 107

 Score =  132 bits (331), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 75/102 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG  +F  +CA+CH        K GP LHGLFGRKTG   G++YTDANK KGITW 
Sbjct: 5   GDSKKGANLFKTRCAECHGEGGNLTQKIGPALHGLFGRKTGSVDGYAYTDANKQKGITWD 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL EYLENPKKYIPGTKM F G+KK  +R D+I ++K+AT
Sbjct: 65  ENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDIITFMKEAT 106


Go to top
>tr|Q4CV48|Q4CV48_TRYCR Cytochrome c, putative.
          Length = 114

 Score =  129 bits (323), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (76%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+KIF  + AQCHT  KGG +  GPNL+G++GR++G   GF+Y+ AN++ G+ W 
Sbjct: 12  GDAAKGEKIFKGRAAQCHTGTKGGANGVGPNLYGIYGRRSGTVEGFAYSKANQDSGVVWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E+ L  YLENPKK++PGTKM FAG+KK  ERADLIAYL
Sbjct: 72  EEVLDVYLENPKKFMPGTKMAFAGLKKPQERADLIAYL 109


Go to top
>prf|3110434HRF|cytochrome c
          Length = 113

 Score =  128 bits (322), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 3/105 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           G+VE G K+F  +CAQCHT   G  +K GPNL+GLF  K+    G++Y+D NKN G   I
Sbjct: 8   GNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNKNTGKFCI 67

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            WGE TL +YLENPKKYIP TKM FAG K + +RAD++AYL+++T
Sbjct: 68  MWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQST 112


Go to top
>sp|Q869N1|CYC_DICDI Cytochrome c.
          Length = 113

 Score =  128 bits (322), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 3/105 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           G+VE G K+F  +CAQCHT   G  +K GPNL+GLF  K+    G++Y+D NKN G   I
Sbjct: 8   GNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNKNTGKFCI 67

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            WGE TL +YLENPKKYIP TKM FAG K + +RAD++AYL+++T
Sbjct: 68  MWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQST 112


Go to top
>prf|3307400C|cytochrome c
          Length = 113

 Score =  127 bits (320), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYVPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>tr|A3E3B3|A3E3B3_PFIPI Cytochrome c.
          Length = 113

 Score =  127 bits (320), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYVPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|3307400G|cytochrome c
          Length = 113

 Score =  127 bits (319), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYLPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>tr|A3E3B7|A3E3B7_PFIPI Cytochrome c.
          Length = 113

 Score =  127 bits (319), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYLPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>tr|Q4D480|Q4D480_TRYCR Cytochrome c, putative.
          Length = 114

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (75%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+KIF  + AQCHT  KGG +  GPNL+G++GR +G   GF+Y+ AN++ G+ W 
Sbjct: 12  GDAAKGEKIFKGRAAQCHTGTKGGANGVGPNLYGIYGRHSGTVEGFAYSKANQDSGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E+ L  YLENPKK++PGTKM FAG+KK  ERADLIAYL
Sbjct: 72  EEVLDVYLENPKKFMPGTKMAFAGLKKPQERADLIAYL 109


Go to top
>prf|3307400J|cytochrome c
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|3307400H|cytochrome c
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|3307400F|cytochrome c
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|3307400E|cytochrome c
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|3307400D|cytochrome c
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>tr|A3E3B4|A3E3B4_PFIPI Cytochrome c.
          Length = 113

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FAG+KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFAGVKKEKERADLVAFM 109


Go to top
>prf|730760A|cytochrome c
          Length = 102

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 77/99 (77%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F  + AQCH+ +KG  + TGP+L G++GR +G   G++Y++ANKN  I W 
Sbjct: 1   GDAERGKKLFESRAAQCHSAQKG-VNSTGPSLWGVYGRTSGSVPGYAYSNANKNAAIVWE 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E+TL ++LENPKKY+PGTKM FAGIK K +R D+IAY+K
Sbjct: 60  EETLHKFLENPKKYVPGTKMAFAGIKAKKDRQDIIAYMK 98


Go to top
>sp|P00076|CYC_EUGGR Cytochrome c.
          Length = 102

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 77/99 (77%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F  + AQCH+ +KG  + TGP+L G++GR +G   G++Y++ANKN  I W 
Sbjct: 1   GDAERGKKLFESRAAQCHSAQKG-VNSTGPSLWGVYGRTSGSVPGYAYSNANKNAAIVWE 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E+TL ++LENPKKY+PGTKM FAGIK K +R D+IAY+K
Sbjct: 60  EETLHKFLENPKKYVPGTKMAFAGIKAKKDRQDIIAYMK 98


Go to top
>tr|A4H8R0|A4H8R0_LEIBR Cytochrome c, putative.
          Length = 113

 Score =  125 bits (315), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 73/99 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  RK+G   GF+Y+ AN + G+ W 
Sbjct: 12  GDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRKSGTIEGFAYSKANADSGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>prf|3307400K|cytochrome c
          Length = 113

 Score =  125 bits (314), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FA +KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFASVKKEKERADLVAFM 109


Go to top
>tr|A3E3C0|A3E3C0_PFIPI Cytochrome c.
          Length = 113

 Score =  125 bits (314), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV+KG K+F  KCAQCHT+EKGG  K GP L G+ GR +G +  F Y++ANKN GITW 
Sbjct: 13  GDVKKGAKLFKAKCAQCHTIEKGGNAKQGPPLWGVMGRPSG-SCDFGYSEANKNSGITWS 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  +  YL +PKKY+PGTKM+FA +KK+ ERADL+A++
Sbjct: 72  DKHMFVYLIDPKKYMPGTKMVFASVKKEKERADLVAFM 109


Go to top
>tr|A8PJQ3|A8PJQ3_BRUMA Cytochrome c type-1, putative.
          Length = 108

 Score =  125 bits (314), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 75/102 (73%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F  +C QCH ++    +K GP L G+ GRK+G   G+ Y+ ANKNKG+ W 
Sbjct: 6   GDYERGKKLFKMRCLQCHVIDSDA-NKNGPTLKGVIGRKSGTVDGYPYSSANKNKGVVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +TL EYL +PKKYIPGTKM+FAG+KK  ERADLI ++++ +
Sbjct: 65  RETLFEYLLDPKKYIPGTKMVFAGLKKPQERADLIKFIEEES 106


Go to top
>tr|A4HX28|A4HX28_LEIIN Cytochrome c, putative.
          Length = 251

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  R +G+  GF+Y+ AN   G+ W 
Sbjct: 150 GDVERGEKLFKGRAAQCHTATKGGANGVGPNLFGIVHRPSGKVEGFAYSKANAESGVVWT 209

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 210 PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 248


Go to top
>prf|3114405NDK|cytochrome c
          Length = 113

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  R +G+  GF+Y+ AN   G+ W 
Sbjct: 12  GDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>prf|3114405NDJ|cytochrome c
          Length = 113

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  R +G+  GF+Y+ AN   G+ W 
Sbjct: 12  GDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>tr|Q4QEN5|Q4QEN5_LEIMA Cytochrome c, putative (Cytochrome c).
          Length = 113

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  R +G+  GF+Y+ AN   G+ W 
Sbjct: 12  GDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>tr|A4H8Q9|A4H8Q9_LEIBR Cytochrome c, putative.
          Length = 114

 Score =  124 bits (310), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+G+K+F  + AQCHT  KGG +  GPNL G+  RK+G   GF+Y+ AN + G+ W 
Sbjct: 12  GDAERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIINRKSGTIEGFAYSKANADSGVIWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>tr|A4HX29|A4HX29_LEIIN Cytochrome c, putative.
          Length = 113

 Score =  123 bits (309), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE+G+K+F  + AQCHT  KGG +  GPNL G+  R +G+  GF+Y+ AN   G+ W 
Sbjct: 12  GDVERGEKLFKGRAAQCHTATKGGANGVGPNLFGIVHRPSGKVEGFTYSKANAESGVVWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERAD+IAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLE 110


Go to top
>prf|3114407FND|cytochrome c
          Length = 114

 Score =  123 bits (309), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 73/99 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+K+F  + AQCHT  KGG +  GPNL+G+ GRK+G   GF+Y+ AN++ G+ W 
Sbjct: 12  GDAVRGEKLFKGRAAQCHTGTKGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
              L  YLENPKK++PGTKM FAG+KK  ERADLIAYL+
Sbjct: 72  PQVLDVYLENPKKFMPGTKMSFAGLKKPQERADLIAYLE 110


Go to top
>prf|3114405FND|cytochrome c
          Length = 114

 Score =  123 bits (309), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 73/99 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+K+F  + AQCHT  KGG +  GPNL+G+ GRK+G   GF+Y+ AN++ G+ W 
Sbjct: 12  GDAVRGEKLFKGRAAQCHTGTKGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
              L  YLENPKK++PGTKM FAG+KK  ERADLIAYL+
Sbjct: 72  PQVLDVYLENPKKFMPGTKMSFAGLKKPQERADLIAYLE 110


Go to top
>tr|Q57UI4|Q57UI4_9TRYP Cytochrome c.
          Length = 114

 Score =  123 bits (309), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 73/99 (73%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+K+F  + AQCHT  KGG +  GPNL+G+ GRK+G   GF+Y+ AN++ G+ W 
Sbjct: 12  GDAVRGEKLFKGRAAQCHTGTKGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
              L  YLENPKK++PGTKM FAG+KK  ERADLIAYL+
Sbjct: 72  PQVLDVYLENPKKFMPGTKMSFAGLKKPQERADLIAYLE 110


Go to top
>prf|2214401A|cytochrome c
          Length = 108

 Score =  122 bits (307), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GK+IF  +C  CH V+   K K+GP+L+G+FGR+ G   G+ Y++ANKN  I W 
Sbjct: 6   GDYERGKQIFKTRCLMCHVVD-SDKAKSGPSLNGIFGRRAGTVKGYDYSNANKNANIVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           ++T+ +YL NPKKY+PG+KMIFAG+KK  +RADLI Y++
Sbjct: 65  KETMFDYLANPKKYMPGSKMIFAGLKKVEDRADLIRYIE 103


Go to top
>prf|752390A|cytochrome c555
          Length = 112

 Score =  122 bits (306), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+K+F  + AQCHT  +GG +  GPNL+GL GR +G   G++Y+ AN + G+ W 
Sbjct: 10  GDAARGEKLFKGRAAQCHTANQGGANGVGPNLYGLVGRHSGTIEGYAYSKANADSGVVWT 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L  YLENPKK++PGTKM FAG+KK  ERAD+IAYL+
Sbjct: 70  PDVLDVYLENPKKFMPGTKMSFAGMKKPQERADVIAYLE 108


Go to top
>sp|P22342|CYC_EUGVI Cytochrome c.
          Length = 102

 Score =  122 bits (305), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F  +  QCH+ +KG  + TGP L+G++GR +G   G++Y++ANKN  I W 
Sbjct: 1   GDAERGKKLFESRAGQCHSSQKG-VNSTGPALYGVYGRTSGTVPGYAYSNANKNAAIVWE 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +++L ++LENPKKY+PGTKM FAGIK K +R D+IAY+K
Sbjct: 60  DESLNKFLENPKKYVPGTKMAFAGIKAKKDRLDIIAYMK 98


Go to top
>sp|P00078|CYC_CRIFA Cytochrome c (Cytochrome c555).
          Length = 114

 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+K+F  + AQCHT  +GG +  GPNL+GL GR +G   G++Y+ AN   G+ W 
Sbjct: 12  GDAARGEKLFKGRAAQCHTANQGGANGVGPNLYGLVGRHSGTIEGYAYSKANAESGVVWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L  YLENPKK++PGTKM FAG+KK  ERAD+IAYL+
Sbjct: 72  PDVLDVYLENPKKFMPGTKMSFAGMKKPQERADVIAYLE 110


Go to top
>tr|O22490|O22490_ORYSA Cytochrome C.
          Length = 106

 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/97 (57%), Positives = 72/97 (74%), Gaps = 2/97 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+ + G+KIF  KCAQCHTV+KG  HK GPNL+GLFGR++G   G+SY+ ANKN  + W 
Sbjct: 10  GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAY 98
           E+TL +YL NPKKYIP TKM+F G+K    R+ LI +
Sbjct: 70  ENTLYDYLLNPKKYIPETKMVFPGLKN--HRSVLILF 104


Go to top
>sp|P00077|CYC_CRION Cytochrome c (Cytochrome c557).
          Length = 113

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 70/99 (70%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+KIF  + AQCHT  KGG +  GPNL G+  R +G   GF+Y+ AN + G+ W 
Sbjct: 12  GDAAKGEKIFKGRAAQCHTGAKGGANGVGPNLFGIVNRHSGTVEGFAYSKANADSGVVWT 71

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERADLIAYL+
Sbjct: 72  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADLIAYLE 110


Go to top
>prf|720975A|cytochrome c
          Length = 111

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 70/99 (70%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+KIF  + AQCHT  KGG +  GPNL G+  R +G   GF+Y+ AN + G+ W 
Sbjct: 10  GDAAKGEKIFKGRAAQCHTGAKGGANGVGPNLFGIVNRHSGTVEGFAYSKANADSGVVWT 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  YLENPKK++PGTKM FAGIKK  ERADLIAYL+
Sbjct: 70  PEVLDVYLENPKKFMPGTKMSFAGIKKPQERADLIAYLE 108


Go to top
>prf|1712125C|cytochrome c
          Length = 102

 Score =  120 bits (300), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F  +  QCH+ +KG  + TGP L+G++GR +G   G++Y++ANKN  I W 
Sbjct: 1   GDAERGKKLFESRAGQCHSSQKG-VNSTGPALYGVYGRTSGTVPGYAYSNANKNAAIVWE 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +++L ++LENPKKY+PGTKM FAGI  K +R D+IAY+K
Sbjct: 60  DESLNKFLENPKKYVPGTKMAFAGIXAKKDRLDIIAYMK 98


Go to top
>sp|P92505|CYC2_ASCSU Cytochrome c type-2.
          Length = 109

 Score =  120 bits (300), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 73/99 (73%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK+IF  +C  CH V+   K K+GP+L+G+FG   G   G+ Y++ANKN  I W 
Sbjct: 7   GDYESGKQIFKTRCLMCHVVD-SDKAKSGPSLNGIFGSSAGTVKGYDYSNANKNANIVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           ++T+ +YL NPKKY+PG+KMIFAG+KK  +RADLI+Y++
Sbjct: 66  KETMFDYLANPKKYMPGSKMIFAGLKKVEDRADLISYIE 104


Go to top
>prf|760999B|cytochrome c2
          Length = 107

 Score =  119 bits (299), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F Q C  CH++  G K+K GP L+GLFGR +G   GFSY+DANKN GITW E
Sbjct: 2   DAASGEQVFKQ-CKVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFSYSDANKNSGITWTE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +   EY+ +PK  IPGTKMIFAGIK + + +DLIAYLK+
Sbjct: 61  EVFREYIRDPKAKIPGTKMIFAGIKDEQKVSDLIAYLKQ 99


Go to top
>tr|Q8S0R8|Q8S0R8_ORYSJ Putative cytochrome c (Os01g0885000
           protein).
          Length = 111

 Score =  118 bits (295), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+KIF  KCA CH V+K   HK GPNL+GLFGR++G A GFSY   +K   + W 
Sbjct: 10  GDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSGDKIVPVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E+TL +YL  PKKY P  KM F G+K+  +RADLIAYLK AT
Sbjct: 70  ENTLYDYLLTPKKYTPA-KMGFNGLKQPQDRADLIAYLKNAT 110


Go to top
>pdb|1IO3_A|1.90| 1| 107|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2;
           CHAIN: A          
          Length = 107

 Score =  117 bits (293), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F Q C  CH++  G K+K GP L+GLFGR +G   GF+Y+DANKN GITW E
Sbjct: 2   DAASGEQVFKQ-CLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDANKNSGITWTE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +   EY+ +PK  IPGTKMIFAG+K + + +DLIAY+K+
Sbjct: 61  EVFREYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQ 99


Go to top
>pdb|1CRY|3.0 | 1| 107|N|CYTOCHROME C2                            
                       
          Length = 107

 Score =  117 bits (293), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F Q C  CH++  G K+K GP L+GLFGR +G   GF+Y+DANKN GITW E
Sbjct: 2   DAASGEQVFKQ-CLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDANKNSGITWTE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +   EY+ +PK  IPGTKMIFAG+K + + +DLIAY+K+
Sbjct: 61  EVFREYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQ 99


Go to top
>pdb|1CO6_A|1.6 | 1| 107|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2;
           CHAIN: A; BIOLOGICA
          Length = 107

 Score =  117 bits (293), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F Q C  CH++  G K+K GP L+GLFGR +G   GF+Y+DANKN GITW E
Sbjct: 2   DAASGEQVFKQ-CLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDANKNSGITWTE 60

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +   EY+ +PK  IPGTKMIFAG+K + + +DLIAY+K+
Sbjct: 61  EVFREYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQ 99


Go to top
>tr|A2WXP5|A2WXP5_ORYSI Putative uncharacterized protein.
          Length = 112

 Score =  116 bits (291), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+KIF  KCA CH V+K   HK GPNL+GLFGR++G A GFSY   +K   + W 
Sbjct: 10  GDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSGDKIVPVIWE 69

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           E+TL +YL  PKKY P  KM F G+K+  +RADLIAYLK   N
Sbjct: 70  ENTLYDYLLTPKKYTPA-KMGFNGLKQPQDRADLIAYLKNVCN 111


Go to top
>tr|A3WHT0|A3WHT0_9SPHN Cytochrome c family protein.
          Length = 152

 Score =  116 bits (290), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%), Gaps = 3/104 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+ +F Q C  CH VE+G K+  GP+L+G+ GR+ G   GF+Y+DAN N GITW 
Sbjct: 52  GDASAGETVFAQ-CRTCHLVEEG-KNGVGPSLYGVIGREAGSIEGFNYSDANANSGITWT 109

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            + + EYLE P++Y+PGT+M F G+K   +RAD+IAYL  AT+E
Sbjct: 110 PEVMFEYLEAPREYMPGTRMAFPGLKDPQDRADVIAYL-DATDE 152


Go to top
>prf|1616291A|cytochrome c2
          Length = 127

 Score =  115 bits (287), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 71/95 (74%), Gaps = 1/95 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+++F Q C  CH++  G K+K GP L+GLFGR +G   GF+Y+DANKN GITW E+   
Sbjct: 26  GEQVFKQ-CLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDANKNSGITWTEEVFR 84

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           EY+ +PK  IPGTKMIFAG+K + + +DLIAY+K+
Sbjct: 85  EYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQ 119


Go to top
>sp|P00083|CYC2_RHOVI Cytochrome c2 precursor.
          Length = 127

 Score =  115 bits (287), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 71/95 (74%), Gaps = 1/95 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+++F Q C  CH++  G K+K GP L+GLFGR +G   GF+Y+DANKN GITW E+   
Sbjct: 26  GEQVFKQ-CLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDANKNSGITWTEEVFR 84

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           EY+ +PK  IPGTKMIFAG+K + + +DLIAY+K+
Sbjct: 85  EYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQ 119


Go to top
>tr|B2IAX0|B2IAX0_9RHIZ Cytochrome c class I precursor.
          Length = 132

 Score =  112 bits (281), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E G+KIF  KC  CH +  G K+  GP L+GL GRK G + G++Y+DA KN G+TW 
Sbjct: 25  GDPEAGEKIFTTKCKVCHQIGPGAKNFVGPELNGLIGRKAGTSEGYTYSDAMKNSGLTWD 84

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E T  +Y++NPK  +PG KMIFAG+ K+ ++ +L AYL
Sbjct: 85  EATFKDYIKNPKAKLPGIKMIFAGLPKESDQDNLTAYL 122


Go to top
>prf|3019327C|cytochrome c precursor
          Length = 123

 Score =  112 bits (280), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D + G+K+F Q C  CHT+E GG ++ GPNLHG+ GR +G    F Y+DA K  G+TW E
Sbjct: 24  DADAGEKVFNQ-CKACHTIEAGGPNRVGPNLHGVVGRPSGSIESFKYSDAMKGAGLTWDE 82

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             L +YL +PK  +PG KM FAG+K +  R DLIA+LKK
Sbjct: 83  ANLDKYLTDPKGTVPGNKMAFAGVKNEQARKDLIAFLKK 121


Go to top
>tr|Q64I04|Q64I04_AZOBR Cytochrome c.
          Length = 123

 Score =  112 bits (280), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D + G+K+F Q C  CHT+E GG ++ GPNLHG+ GR +G    F Y+DA K  G+TW E
Sbjct: 24  DADAGEKVFNQ-CKACHTIEAGGPNRVGPNLHGVVGRPSGSIESFKYSDAMKGAGLTWDE 82

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             L +YL +PK  +PG KM FAG+K +  R DLIA+LKK
Sbjct: 83  ANLDKYLTDPKGTVPGNKMAFAGVKNEQARKDLIAFLKK 121


Go to top
>prf|3110385DLM|cytochrome c2
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|Q8FXA6|Q8FXA6_BRUSU Cytochrome c2.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|Q579S1|Q579S1_BRUAB CycA, cytochrome c2.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|Q2YIS2|Q2YIS2_BRUA2 Cytochrome c heme-binding site:Cytochrome c,
           class IA/ IB:Cytochrome c, class I.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|A9WXN0|A9WXN0_BRUSI Putative uncharacterized protein.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|A9MDT1|A9MDT1_BRUC2 Cytochrome c2.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|A5VTS2|A5VTS2_BRUO2 Cytochrome c heme-binding site:cytochrome c,
           class IA/ IB:cytochrome c, class I.
          Length = 131

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W 
Sbjct: 24  ADIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E+   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 83  EEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 122


Go to top
>tr|A3WRV1|A3WRV1_9BRAD Cytochrome c, class I.
          Length = 184

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (71%)

Query: 10  IFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYL 69
           +  +KCA CHT+EKGG ++ GPNL+G+ G   G+   F+++ A K KG TW  D L ++L
Sbjct: 88  VVAKKCAACHTLEKGGPNRVGPNLYGIVGEPRGKGRDFNFSAAMKAKGGTWTLDELDKFL 147

Query: 70  ENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            NPK+YIPGT M FAG+ K  +RADLIAYL+K +++
Sbjct: 148 TNPKEYIPGTAMSFAGVPKDSDRADLIAYLRKNSDQ 183


Go to top
>tr|Q8YB33|Q8YB33_BRUME CYTOCHROME C2.
          Length = 116

 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D+E GKKIF   C  CH + +G K+  GP L+GLFGR +G   G+ Y+DANKN GI W E
Sbjct: 10  DIESGKKIF-NACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDE 68

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +   +Y++ P++ IP TKM++AG+K +G+  DLIA+LK+
Sbjct: 69  EIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQ 107


Go to top
>sp|P00084|CYC2_RHOAC Cytochrome c2.
          Length = 107

 Score =  110 bits (275), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G+K+F+ KCA CH +  G K+  GP+L+G+  RK GQA GF+Y+DANKN G+TW 
Sbjct: 2   GDPDAGQKVFL-KCAACHKIGPGAKNGVGPSLNGVANRKAGQAEGFAYSDANKNSGLTWD 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E T  EY+  P+K +PGTKM F G+  + +R ++ AYL +
Sbjct: 61  EATFKEYITAPQKKVPGTKMTFPGLPNEADRDNIWAYLSQ 100


Go to top
>prf|3206257MY|cytochrome c
          Length = 185

 Score =  110 bits (275), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%)

Query: 10  IFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYL 69
           +  +KCA CHT EKGG ++ GPNL+G+ G   GQ   F+++ A K KG TW  D L ++L
Sbjct: 89  VVAKKCAACHTFEKGGPNRVGPNLYGIVGEPRGQGHDFNFSAAMKAKGGTWTLDELDKFL 148

Query: 70  ENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            NPK+YIPGT M F G+ K  +RADLIAYL+K +++
Sbjct: 149 ANPKEYIPGTAMSFVGVPKDSDRADLIAYLRKNSDK 184


Go to top
>tr|Q3SVY7|Q3SVY7_NITWN Cytochrome c, class I precursor.
          Length = 185

 Score =  110 bits (275), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%)

Query: 10  IFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYL 69
           +  +KCA CHT EKGG ++ GPNL+G+ G   GQ   F+++ A K KG TW  D L ++L
Sbjct: 89  VVAKKCAACHTFEKGGPNRVGPNLYGIVGEPRGQGHDFNFSAAMKAKGGTWTLDELDKFL 148

Query: 70  ENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            NPK+YIPGT M F G+ K  +RADLIAYL+K +++
Sbjct: 149 ANPKEYIPGTAMSFVGVPKDSDRADLIAYLRKNSDK 184


Go to top
>prf|760999A|cytochrome c2
          Length = 104

 Score =  109 bits (273), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+++F Q C  CH V    K+  GP  + +FG+K G   GF+Y+DA KN G+TW 
Sbjct: 2   GDPVKGEQVFKQ-CKICHQVGPTAKNGVGPEQNDVFGQKAGARPGFNYSDAMKNSGLTWD 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YLENPK  +PGTKM+F G+K   +RAD+IAYLK+ +
Sbjct: 61  EATLDKYLENPKAVVPGTKMVFVGLKNPQDRADVIAYLKQLS 102


Go to top
>sp|P00082|CYC2_RHOVA Cytochrome c2.
          Length = 104

 Score =  109 bits (273), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+++F Q C  CH V    K+  GP  + +FG+K G   GF+Y+DA KN G+TW 
Sbjct: 2   GDPVKGEQVFKQ-CKICHQVGPTAKNGVGPEQNDVFGQKAGARPGFNYSDAMKNSGLTWD 60

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E TL +YLENPK  +PGTKM+F G+K   +RAD+IAYLK+ +
Sbjct: 61  EATLDKYLENPKAVVPGTKMVFVGLKNPQDRADVIAYLKQLS 102


Go to top
>prf|3323271FD|cytochrome c
          Length = 187

 Score =  108 bits (269), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             VEKG  +  ++CA CH   +G   K GP+L+G+ GRK    AGF+Y+ A + KG  W 
Sbjct: 71  ASVEKGANV-AKRCASCHNFAEGAGAKVGPDLYGVVGRKKASVAGFAYSSALQGKGGDWS 129

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            D L  +L NPK Y+PGT M FAGI K+ ERADLIAYL
Sbjct: 130 FDDLNAFLTNPKAYVPGTAMAFAGIPKESERADLIAYL 167


Go to top
>tr|A8IGU6|A8IGU6_AZOC5 Cytochrome c.
          Length = 187

 Score =  108 bits (269), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             VEKG  +  ++CA CH   +G   K GP+L+G+ GRK    AGF+Y+ A + KG  W 
Sbjct: 71  ASVEKGANV-AKRCASCHNFAEGAGAKVGPDLYGVVGRKKASVAGFAYSSALQGKGGDWS 129

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            D L  +L NPK Y+PGT M FAGI K+ ERADLIAYL
Sbjct: 130 FDDLNAFLTNPKAYVPGTAMAFAGIPKESERADLIAYL 167


Go to top
>tr|A3UDF9|A3UDF9_9RHOB Cytochrome c family protein.
          Length = 137

 Score =  107 bits (268), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +V+ G +IF ++C  CHTVE+GG++  GPNLHG+FGR++G    F Y+ A     + W 
Sbjct: 36  ANVDNGARIF-RRCQACHTVEEGGRNMVGPNLHGVFGRESGHKDDFRYSPAMSESEVVWS 94

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            +TL  YL NP++YI G +M FAG++ + +R DLIA+L   T+
Sbjct: 95  AETLDAYLTNPREYIRGNRMSFAGLRDEQDRHDLIAWLAINTH 137


Go to top
>tr|A2Q5Y1|A2Q5Y1_MEDTR Cytochrome c, monohaem.
          Length = 107

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+KIF   CAQCH+   G  HK GPNL+GLFG ++G    +SY  ANKN  + W E  + 
Sbjct: 15  GEKIFRSDCAQCHS-NIGAVHKQGPNLNGLFGSQSGTTPEYSYCVANKNMSMNWEEKIMD 73

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +YL NP KYI  TKM+F  +KK  ER DLIAYLK
Sbjct: 74  DYLLNPNKYILDTKMVFPALKKPQERVDLIAYLK 107


Go to top
>prf|3401267CWU|cytochrome c
          Length = 171

 Score =  107 bits (267), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F +KC  CH+ E  GK+K GP+L  + GRK G   GF+Y+DA K+ G+TW 
Sbjct: 72  GDAEAGKTLF-KKCGFCHSTE-AGKNKVGPSLAAIVGRKAGVEPGFNYSDALKSSGLTWD 129

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E TL +++ENPK  + GTKMIF GIK + +R +LIAYLK
Sbjct: 130 EATLNKWVENPKGLVSGTKMIFPGIKDEKDRQNLIAYLK 168


Go to top
>tr|Q0BQU4|Q0BQU4_GRABC Cytochrome c.
          Length = 171

 Score =  107 bits (267), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F +KC  CH+ E  GK+K GP+L  + GRK G   GF+Y+DA K+ G+TW 
Sbjct: 72  GDAEAGKTLF-KKCGFCHSTE-AGKNKVGPSLAAIVGRKAGVEPGFNYSDALKSSGLTWD 129

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E TL +++ENPK  + GTKMIF GIK + +R +LIAYLK
Sbjct: 130 EATLNKWVENPKGLVSGTKMIFPGIKDEKDRQNLIAYLK 168


Go to top
>tr|A7IBX2|A7IBX2_XANP2 Cytochrome c class I precursor.
          Length = 148

 Score =  107 bits (266), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F Q C  CH V    K+  GP L+GL GRK G   G++Y+ A K+ GITW +
Sbjct: 42  DAASGEKVFAQ-CRACHQVGPNAKNAVGPVLNGLMGRKAGTYEGYTYSQAMKDSGITWTD 100

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           D+   Y+ NP+  +PGTKM FAG+K  G+ ADL+AYLK+
Sbjct: 101 DSFSTYIMNPRSKVPGTKMAFAGVKDPGKVADLLAYLKR 139


Go to top
>tr|A7HW37|A7HW37_PARL1 Cytochrome c class I precursor.
          Length = 132

 Score =  107 bits (266), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 66/104 (63%), Gaps = 4/104 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---IT 59
           D+  GKKIF  +C  CHT+E+GGK   GPNLHG+FGR  G   G  ++ A   KG   + 
Sbjct: 27  DLADGKKIFA-RCKACHTLEEGGKDGIGPNLHGVFGRTAGTKEGVKFSKAMTAKGAEGLV 85

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           W E+TL  YLE P   +PGT M F G+KK+ +RA LIAYLK  T
Sbjct: 86  WSEETLSVYLEKPAAMVPGTNMAFPGLKKEEDRASLIAYLKSET 129


Go to top
>prf|3206257EFQ|cytochrome c
          Length = 133

 Score =  106 bits (265), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE GK  F  KC  CH + +G K+K GP L+GL GR +G   G++Y+ ANK  GITW 
Sbjct: 25  GDVEAGKSAF-NKCKACHEIGEGAKNKVGPELNGLDGRHSGAVEGYAYSPANKASGITWT 83

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E    EY+++PK  +PGTKM+FAGIKK  E  +L AY+ +
Sbjct: 84  EAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAYVSQ 123


Go to top
>tr|Q3SPF6|Q3SPF6_NITWN Cytochrome c, class I.
          Length = 133

 Score =  106 bits (265), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE GK  F  KC  CH + +G K+K GP L+GL GR +G   G++Y+ ANK  GITW 
Sbjct: 25  GDVEAGKSAF-NKCKACHEIGEGAKNKVGPELNGLDGRHSGAVEGYAYSPANKASGITWT 83

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E    EY+++PK  +PGTKM+FAGIKK  E  +L AY+ +
Sbjct: 84  EAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAYVSQ 123


Go to top
>tr|Q9A8Y7|Q9A8Y7_CAUCR Cytochrome c family protein.
          Length = 155

 Score =  105 bits (263), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+  G+  F   C  CHT+ +GG   TGPNL+G+FGRK G   G+S++DA K  G  W 
Sbjct: 48  GDLSNGQSKFAL-CRSCHTITEGGPDLTGPNLYGVFGRKAGVKEGYSFSDAVKAAGFIWD 106

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
              L ++L +P+ ++PGTKM FAGIK + +R DLIAYLK  T
Sbjct: 107 AQQLDKWLADPRGFMPGTKMTFAGIKNEKDRIDLIAYLKVET 148


Go to top
>tr|A3WT90|A3WT90_9BRAD Cytochrome c, class I.
          Length = 133

 Score =  105 bits (262), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE GK  F  KC  CH + +G K+K GP L+GL GR  G   G++Y+DA K  GITW 
Sbjct: 25  GDVEAGKSSF-NKCKACHEIGEGAKNKVGPELNGLDGRHAGSLEGYAYSDAMKKSGITWN 83

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           +    EY++NPK  +PG KM+FAGIKK+ E  +L AY+ +
Sbjct: 84  QAEFEEYIKNPKAKVPGVKMVFAGIKKQSELDNLWAYVSQ 123


Go to top
>tr|Q1QIK7|Q1QIK7_NITHX Cytochrome c, class I precursor.
          Length = 133

 Score =  105 bits (261), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 63/89 (70%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
            KC  CH + +G K+K GP L+GL GR +G  AG++Y+DANKN GITW E    EY+++P
Sbjct: 35  NKCKACHDIGEGAKNKVGPELNGLDGRHSGAVAGYAYSDANKNSGITWNEAEFKEYIKDP 94

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           K  +PGTKM FAGIKK+ E  +L AY+ +
Sbjct: 95  KAKVPGTKMSFAGIKKQSELDNLWAYVSE 123


Go to top
>sp|Q45233|CY550_BRAJA Cytochrome c-550 precursor (Cytochrome c550).
          Length = 136

 Score =  105 bits (261), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   GK  F  KC  CH + +G K+K GP L+GL GRK+G A  +SY+DANKN GITW E
Sbjct: 30  DAAAGKTSF-NKCLACHAIGEGAKNKVGPELNGLNGRKSGTAPDYSYSDANKNSGITWDE 88

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            T  EY+++PK  IPGTKM FAGIK + E  +L  ++ +
Sbjct: 89  ATFKEYIKDPKAKIPGTKMAFAGIKNETEINNLWTFVSQ 127


Go to top
>tr|Q2IZ83|Q2IZ83_RHOP2 Cytochrome c, class I precursor.
          Length = 183

 Score =  104 bits (259), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             VEKG     +KCA CHT EK G ++ GPNL+G+ G K G+  GF+++ A K KG  W 
Sbjct: 72  ASVEKGVSA-AKKCAACHTFEKDGPNRVGPNLYGIVGEKKGEGRGFNFSAAMKAKGGEWT 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            D L ++L +PK YIPGT M FAGI    ERADLIAYL K ++
Sbjct: 131 FDDLNKFLASPKGYIPGTAMGFAGISNDKERADLIAYLNKNSD 173


Go to top
>tr|Q07K37|Q07K37_RHOP5 Cytochrome c, class I precursor.
          Length = 184

 Score =  104 bits (259), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
              EKG     +KCA CHT EKGG ++ GPNL G+ GR      GF+Y+ A K+KG  W 
Sbjct: 73  ASAEKGASA-AKKCASCHTFEKGGPNRVGPNLFGVVGRDRAVEPGFNYSAAMKSKGGKWT 131

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  ++ NPK  +PGT M FAG+ K GERADLIAYL+
Sbjct: 132 FEELNAFIANPKGTVPGTAMSFAGVPKDGERADLIAYLR 170


Go to top
>tr|B1WIW5|B1WIW5_OLICA Cytochrome c2.
          Length = 125

 Score =  103 bits (258), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+K+F   C  CH + +  K+  GP L+GL GRK G  AG++Y+ ANKN G+TW E T  
Sbjct: 24  GEKVFAA-CKACHQIGETAKNGVGPELNGLIGRKAGSVAGYNYSAANKNSGLTWDEATFR 82

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           EY+++PK  +PGTKMI+AG+K + +  DL+A+LK+
Sbjct: 83  EYIKDPKAKVPGTKMIYAGLKDQKKTDDLVAFLKQ 117


Go to top
>prf|3101377HEF|cytochrome c family protein
          Length = 121

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F +KCA CH +E+G K+K GP++ G++ R  G   GF Y+      G TW 
Sbjct: 22  GDPEEGKKVF-KKCAACHAIEEG-KNKVGPSMFGVWERPAGAVEGFKYSQPMAEAGYTWD 79

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E+ L  +L  PKKY+PGTKM F G+KK+ + ADL+AYLK
Sbjct: 80  EEHLAGFLAAPKKYLPGTKMTFPGVKKEEQLADLLAYLK 118


Go to top
>tr|Q5LL49|Q5LL49_SILPO Cytochrome c family protein.
          Length = 121

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E+GKK+F +KCA CH +E+G K+K GP++ G++ R  G   GF Y+      G TW 
Sbjct: 22  GDPEEGKKVF-KKCAACHAIEEG-KNKVGPSMFGVWERPAGAVEGFKYSQPMAEAGYTWD 79

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E+ L  +L  PKKY+PGTKM F G+KK+ + ADL+AYLK
Sbjct: 80  EEHLAGFLAAPKKYLPGTKMTFPGVKKEEQLADLLAYLK 118


Go to top
>tr|A3JVA4|A3JVA4_9RHOB Diheme cytochrome c SoxE.
          Length = 235

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KG 57
           +GD +KG K+F +KC  CH V +G KH+ GP L+GLFGR  G   GF Y+ A       G
Sbjct: 25  IGDPKKGAKVF-KKCKACHQVGEGAKHRVGPQLNGLFGRTAGTLEGFKYSKAMTTAGEDG 83

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + W ++T+ E++ENPK +IP +KM F G+KK+ +R +L+AYL+  ++
Sbjct: 84  LVWTDETIAEFVENPKAFIPKSKMSFKGLKKEKDRVNLLAYLQTFSD 130


Go to top
>tr|A3A0A7|A3A0A7_ORYSJ Putative uncharacterized protein.
          Length = 146

 Score =  103 bits (257), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 72/136 (52%), Gaps = 34/136 (25%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+KIF  KCA CH V+K   HK GPNL+GLFGR++G A GFSY   +K   + W 
Sbjct: 10  GDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSGDKIVPVIWE 69

Query: 62  EDTLMEYLENPKKY---------------------------IPG-------TKMIFAGIK 87
           E+TL +YL  PKK+                           IPG        KM F G+K
Sbjct: 70  ENTLYDYLLTPKKHALALPRCGPKLKIVASLELISDTLGSVIPGITHKYTPAKMGFNGLK 129

Query: 88  KKGERADLIAYLKKAT 103
           +  +RADLIAYLK AT
Sbjct: 130 QPQDRADLIAYLKNAT 145


Go to top
>prf|0810182A|cytochrome c550
          Length = 109

 Score =  103 bits (256), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE GK  F  KC  CH + +  K+K GP L GL GR +G   G++Y+ ANK  GITW 
Sbjct: 1   GDVEAGKAAF-NKCKACHEIGESAKNKVGPELDGLDGRHSGAVEGYAYSPANKASGITWT 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E    EY+++PK  +PGTKM+FAGIKK  E  +L AY+ +
Sbjct: 60  EAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAYVSQ 99


Go to top
>sp|P00085|CY550_NITWI Cytochrome c-550 (Cytochrome c550).
          Length = 109

 Score =  103 bits (256), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDVE GK  F  KC  CH + +  K+K GP L GL GR +G   G++Y+ ANK  GITW 
Sbjct: 1   GDVEAGKAAF-NKCKACHEIGESAKNKVGPELDGLDGRHSGAVEGYAYSPANKASGITWT 59

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E    EY+++PK  +PGTKM+FAGIKK  E  +L AY+ +
Sbjct: 60  EAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAYVSQ 99


Go to top
>tr|A3T0C0|A3T0C0_9RHOB Cytochrome c552.
          Length = 243

 Score =  102 bits (255), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+K+F +KC  CHTVE+ G ++ GPNL+G+ G       GF Y+ A  + G  W 
Sbjct: 140 GDPAAGEKVF-RKCKACHTVEEDGPNRVGPNLYGIVGASVAAVDGFRYSGALTDHGGDWT 198

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            D L  +L NP+K +PGTKM FAG++K  ++AD+IAYL   ++
Sbjct: 199 PDRLAAFLANPRKAVPGTKMSFAGLRKSEDQADVIAYLASLSD 241


Go to top
>tr|A3SFM9|A3SFM9_9RHOB Cytochrome c552.
          Length = 243

 Score =  102 bits (254), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+K+F +KC  CHTVE+ G  + GPNL+G+ G       GF Y+ A  + G  W 
Sbjct: 140 GDPAAGEKVF-RKCKACHTVEEDGPSRVGPNLYGIVGASVAAVDGFRYSGALTDHGGDWT 198

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            D L  +L NP+K +PGTKM FAG++K  ++AD+IAYL   ++
Sbjct: 199 PDRLATFLANPRKAVPGTKMSFAGLRKPEDQADVIAYLASLSD 241


Go to top
>tr|A5VFF8|A5VFF8_SPHWW Cytochrome c, class I.
          Length = 209

 Score =  102 bits (254), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWG 61
           D  KG  +F +KCA CH    GG +  GPNL G+ G   GQ A GF+++DA K+KG TW 
Sbjct: 69  DPAKGADVF-KKCAACHNAANGGPNALGPNLWGVLGEGVGQGAHGFAFSDALKSKGGTWD 127

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              L ++L++PK + PGTKM FAG+ K  +RA++IAYL + +N 
Sbjct: 128 WQNLSDWLKSPKAFAPGTKMTFAGLSKPEDRANVIAYLNQQSNS 171


Go to top
>prf|3311456CED|cytochrome c
          Length = 115

 Score =  102 bits (253), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           GK  F  KC  CH + +G K+K GP L+GL GRK+G    ++Y+DANKN GITW E    
Sbjct: 13  GKTAF-NKCLPCHAIGEGAKNKVGPELNGLDGRKSGTVPDYNYSDANKNSGITWNEAVFK 71

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           EY+++PK  IPGTKM FAGIK + E  +L AY+
Sbjct: 72  EYIKDPKAKIPGTKMTFAGIKSENEINNLWAYV 104


Go to top
>tr|A5ECH7|A5ECH7_BRASB Cytochrome C.
          Length = 115

 Score =  102 bits (253), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           GK  F  KC  CH + +G K+K GP L+GL GRK+G    ++Y+DANKN GITW E    
Sbjct: 13  GKTAF-NKCLPCHAIGEGAKNKVGPELNGLDGRKSGTVPDYNYSDANKNSGITWNEAVFK 71

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           EY+++PK  IPGTKM FAGIK + E  +L AY+
Sbjct: 72  EYIKDPKAKIPGTKMTFAGIKSENEINNLWAYV 104


Go to top
>tr|B0IHV5|B0IHV5_RHOPA Cytochrome c class I precursor.
          Length = 184

 Score =  101 bits (252), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
             V++G K+  +KCA CHT EK G ++ GPNL+G+ G   G+   GF+++ A K KG  W
Sbjct: 71  ASVDQGSKV-AKKCAACHTFEKDGPNRVGPNLYGIVGDHRGEGRNGFNFSAAMKAKGGAW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             D L ++L NPK YIPGT M FAG+    ERADLIAYL K ++
Sbjct: 130 TFDELNKFLANPKGYIPGTAMSFAGVPNDKERADLIAYLNKNSD 173


Go to top
>prf|1503219A|cytochrome c
          Length = 93

 Score =  101 bits (252), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 59/78 (75%)

Query: 23  KGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMI 82
           +GG +  GPNL+G+ GRK+G   GF+Y+ AN++ G+ W    L  YLENPKK++PGTKM 
Sbjct: 12  QGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWTPQVLDVYLENPKKFMPGTKMS 71

Query: 83  FAGIKKKGERADLIAYLK 100
           FAG+KK  ERADLIAYL+
Sbjct: 72  FAGLKKPQERADLIAYLE 89


Go to top
>sp|P18822|CYC_TRYBB Cytochrome c (Fragments).
          Length = 93

 Score =  101 bits (252), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 59/78 (75%)

Query: 23  KGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMI 82
           +GG +  GPNL+G+ GRK+G   GF+Y+ AN++ G+ W    L  YLENPKK++PGTKM 
Sbjct: 12  QGGSNGVGPNLYGIVGRKSGTVEGFTYSKANQDSGVMWTPQVLDVYLENPKKFMPGTKMS 71

Query: 83  FAGIKKKGERADLIAYLK 100
           FAG+KK  ERADLIAYL+
Sbjct: 72  FAGLKKPQERADLIAYLE 89


Go to top
>tr|Q1GVI1|Q1GVI1_SPHAL Cytochrome c, class I precursor.
          Length = 147

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (64%), Gaps = 1/94 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++IF ++C  CHTV+KGG+H  GPNLHG+ G      AGFSY+ A K KG  W E  L 
Sbjct: 52  GEQIF-RRCVACHTVDKGGRHGIGPNLHGIVGAPVAAKAGFSYSGAMKAKGGVWDEAALD 110

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            YL+ P K +PGT+M FAG+    +R  LI YL+
Sbjct: 111 AYLKAPMKDVPGTRMAFAGVVDATDRKALILYLQ 144


Go to top
>tr|Q2TV05|Q2TV05_9RHIZ C-type cytochrome c552.
          Length = 127

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK---GIT 59
           + EKG  +F +KCA CH V  G  +K GP L+GL GRK     GF+Y+ A K K   G  
Sbjct: 23  NAEKGAVVF-KKCAACHAVGDGAANKVGPELNGLIGRKVAGVEGFNYSPAFKAKAEEGWV 81

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           W E  L EYL NPK YI GTKM FAG+KK  + AD+IAYLK
Sbjct: 82  WDEVHLTEYLANPKAYIKGTKMAFAGLKKPEDVADVIAYLK 122


Go to top
>tr|Q1QR79|Q1QR79_NITHX Cytochrome c, class I precursor.
          Length = 184

 Score =  100 bits (250), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           HT EKGG ++ GPNL+G+ G   GQ  GF+++ A K KG TW  D L ++L NPK YIPG
Sbjct: 89  HTFEKGGPNRVGPNLYGIVGEPRGQGRGFNFSAAMKAKGGTWTFDELNKFLTNPKGYIPG 148

Query: 79  TKMIFAGIKKKGERADLIAYLKKATNE 105
           T M FAG+ K  ERAD+IAYL K +++
Sbjct: 149 TAMSFAGVPKDSERADIIAYLNKNSDK 175


Go to top
>tr|Q92WZ0|Q92WZ0_RHIME Putative cytochrome c protein.
          Length = 136

 Score =  100 bits (250), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 68/102 (66%), Gaps = 4/102 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD   G+K+F +KC  CH V    K KTGP L+G+ GR  G+A G++Y+ A       G
Sbjct: 32  VGDPGAGEKVF-RKCQACHAVGPDAKSKTGPLLNGIIGRSAGKAEGYAYSPAMSKAAEAG 90

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +TW  + + E+L +PK ++PGTKM FAG++K  ERAD+IAYL
Sbjct: 91  LTWTPEKIAEFLTSPKGFLPGTKMTFAGLRKDQERADIIAYL 132


Go to top
>sp|Q8UJ37|CYCM_AGRT5 Cytochrome c homolog.
          Length = 192

 Score =  100 bits (249), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (61%), Gaps = 5/104 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT----DANKNKG 57
            D  KG+ +F +KC  CHT E GG +K GPNL  +  R      GFSY+    D +K   
Sbjct: 71  ADAAKGEAVF-KKCTSCHTGESGGANKVGPNLFDVVNRPIASHEGFSYSAGMKDFSKGAS 129

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + W  D L  +LE PKK++PGT M FAG+KK+ ERADLIAYL+ 
Sbjct: 130 VHWDYDHLNYFLEAPKKHVPGTAMGFAGVKKETERADLIAYLRS 173


Go to top
>tr|B1WCW6|B1WCW6_OLICA Putative CytoChrome c-like protein.
          Length = 170

 Score =  100 bits (249), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
            VEKG+    +KCA CHT +KGG +K GPNL G+     G+  GF+++ A K KG +W  
Sbjct: 71  SVEKGQAA-SKKCAACHTFDKGGPNKVGPNLFGVIDEPKGEGRGFNFSAAMKAKGGSWTI 129

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L +++++PK ++PGT M FAGI K  ERADLIAY+K
Sbjct: 130 EDLNQFIKSPKGFVPGTAMGFAGISKDSERADLIAYMK 167


Go to top
>tr|Q3KAB4|Q3KAB4_PSEPF Cytochrome c, class I precursor.
          Length = 128

 Score =  100 bits (249), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E G KIF + C  CH V +  +   GP L+G+ GR  G +A + Y+DA KN G+TW 
Sbjct: 25  GDAEAGAKIFPRLCGGCHQVGESARPGFGPELNGIIGRPAGTSANYVYSDAMKNSGLTWD 84

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            +TL  YL++PK  +PGT+MIF G+  + +  +L+AYL+  + +
Sbjct: 85  RETLTAYLKDPKGVVPGTRMIFWGLSDEEKIDNLLAYLQTFSQQ 128


Go to top
>tr|Q0FSB3|Q0FSB3_9RHOB Cytochrome c family protein.
          Length = 127

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 68/107 (63%), Gaps = 6/107 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA----NKNKG 57
           GD EKG+K+F +KC  CH V +G ++K GP L+G+ GR+     GF Y+DA       KG
Sbjct: 23  GDAEKGEKVF-RKCRACHAVGEGAENKVGPQLNGIVGREIAALEGFGYSDALTELAAEKG 81

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             W E+ L  +LE P+ Y  GTKM FAG++K+ ERAD+IAYL   T 
Sbjct: 82  -AWTEEELAAFLEKPRDYAKGTKMSFAGLRKEDERADVIAYLATFTE 127


Go to top
>prf|3218314AGQ|cytochrome c family protein
          Length = 265

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 62/101 (61%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D+ +G+++F  +C+ CHT+  GG + TGPNLH   G      AGF+Y+ A  N   +W  
Sbjct: 86  DLTRGERLFASQCSTCHTINAGGANGTGPNLHNTVGADKAHIAGFAYSGALSNAEGSWTY 145

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + L E++ NP  Y+ GT M FAGI++  +RA +IAYL   T
Sbjct: 146 ENLNEWINNPSAYVRGTSMSFAGIRRDTDRAAVIAYLAANT 186


Go to top
>tr|Q0C4F6|Q0C4F6_HYPNA Cytochrome c family protein.
          Length = 265

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 62/101 (61%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D+ +G+++F  +C+ CHT+  GG + TGPNLH   G      AGF+Y+ A  N   +W  
Sbjct: 86  DLTRGERLFASQCSTCHTINAGGANGTGPNLHNTVGADKAHIAGFAYSGALSNAEGSWTY 145

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + L E++ NP  Y+ GT M FAGI++  +RA +IAYL   T
Sbjct: 146 ENLNEWINNPSAYVRGTSMSFAGIRRDTDRAAVIAYLAANT 186


Go to top
>tr|A4Z0V6|A4Z0V6_BRASO Cytochrome C.
          Length = 131

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 61/91 (67%)

Query: 9   KIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
           K    KC  CH + +G K+K GP L+GL GRK+G    ++Y++ANKN GITW E    EY
Sbjct: 30  KTSFNKCLPCHAIGEGAKNKVGPELNGLDGRKSGTVPDYNYSEANKNSGITWNEAVFKEY 89

Query: 69  LENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +++PK  IPGTKM FAGIK + E  +L AY+
Sbjct: 90  IKDPKAKIPGTKMTFAGIKNETEVNNLWAYV 120


Go to top
>tr|Q1QFP6|Q1QFP6_NITHX Cytochrome c, class I precursor.
          Length = 235

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 70/103 (67%), Gaps = 3/103 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITW 60
           G+  +G+K F + CA CH++E G ++ TGP+L  L+GRK G    F  Y+DA K  GI W
Sbjct: 23  GNAARGRKDF-KACAPCHSLEPG-RNMTGPSLADLWGRKAGGVLSFDRYSDALKASGIVW 80

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +DTL ++L +P+  +PG +M F GIK  G RADL+A+LK+AT
Sbjct: 81  NDDTLDQWLTDPQNVVPGNEMPFDGIKDVGARADLLAFLKEAT 123


Go to top
>tr|A0C010|A0C010_PARTE Chromosome undetermined scaffold_14, whole
           genome shotgun sequence (Chromosome undetermined
           scaffold_42, whole genome shotgun sequence).
          Length = 116

 Score =  100 bits (248), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  KG+ IF Q+CA CH  E   K  + P L GL GRK G +  F Y+   K  G  W 
Sbjct: 17  GDAAKGRDIFDQQCAACHAFEGDDKTASAPTLGGLLGRKAG-STQFPYSKGMKGAGFNWS 75

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           E  L  +L+NP KY+ GTKM FAG++ + ERADLIAYL
Sbjct: 76  EKHLFVFLKNPSKYVVGTKMAFAGLENEQERADLIAYL 113


Go to top
>tr|A3VJS8|A3VJS8_9RHOB Diheme cytochrome c SoxE.
          Length = 233

 Score = 99.8 bits (247), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
            GD E G KI+ +KC  CH V     ++TGP L+G+FGR      GF Y+D      N G
Sbjct: 24  FGDAEDGAKIY-RKCRACHMVGSEAFNRTGPQLNGIFGRAAASVDGFRYSDGLTRMGNDG 82

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + W  DTL  Y+ENPK +   T+M F G+K  GERADL+A+L++ ++
Sbjct: 83  LVWDFDTLDAYIENPKAFASDTRMNFPGVKDAGERADLLAFLRQYSD 129


Go to top
>tr|Q6N3K0|Q6N3K0_RHOPA Putative cytochrome c precursor.
          Length = 184

 Score = 99.8 bits (247), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
             V++G K+  +KCA CHT EK G ++ GPNL+G+ G   G+   GF+++ A K KG  W
Sbjct: 71  ASVDQGSKV-AKKCAACHTFEKDGPNRVGPNLYGIVGDHRGEGRNGFNFSAAMKAKGGAW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             D L ++L +PK YIPGT M FAG+    ERADLIAYL K ++
Sbjct: 130 TFDELNKFLASPKGYIPGTAMSFAGVPNDKERADLIAYLNKNSD 173


Go to top
>tr|Q2VGA8|Q2VGA8_9RHIZ Putative c2-type cytochrome isoform.
          Length = 127

 Score = 99.8 bits (247), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 64/102 (62%), Gaps = 4/102 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK---GI 58
           GD EKG  +F +KC  CH V +G  +K GP L+ + GRK     GF+Y+ A K K   G 
Sbjct: 22  GDAEKGAVVF-KKCTACHAVGEGAANKVGPELNSIIGRKVAGVEGFNYSPAFKAKAEEGW 80

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            W E  L EYL NPK YI GTKM FAG+KK  + AD+IAYL+
Sbjct: 81  VWDEVHLTEYLANPKAYIKGTKMAFAGLKKPEDVADVIAYLQ 122


Go to top
>prf|3311456DLR|cytochrome c
          Length = 119

 Score = 99.8 bits (247), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           + G+  F + CA CH++E G ++K GP+L G+  R+ G  AGF+Y+ ANKN G+ W  +T
Sbjct: 21  DLGEAQFRKNCAMCHSLEPG-RNKLGPSLFGVLDRRAGTVAGFNYSSANKNSGLVWTRET 79

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           L  YL +P+  +PGT M+F GIK  G+R  L+ +L  
Sbjct: 80  LDAYLADPQTMVPGTLMVFPGIKNGGDRQALVEFLAS 116


Go to top
>tr|A5EEA5|A5EEA5_BRASB Cytochrome c.
          Length = 119

 Score = 99.8 bits (247), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           + G+  F + CA CH++E G ++K GP+L G+  R+ G  AGF+Y+ ANKN G+ W  +T
Sbjct: 21  DLGEAQFRKNCAMCHSLEPG-RNKLGPSLFGVLDRRAGTVAGFNYSSANKNSGLVWTRET 79

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           L  YL +P+  +PGT M+F GIK  G+R  L+ +L  
Sbjct: 80  LDAYLADPQTMVPGTLMVFPGIKNGGDRQALVEFLAS 116


Go to top
>tr|Q126Y3|Q126Y3_POLSJ Cytochrome c, class I precursor.
          Length = 225

 Score = 99.0 bits (245), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITWG 61
           DVE+G ++  + C  CH+   G +H TGP+L G++GR+ G AAGFS Y+DA K   I W 
Sbjct: 29  DVERGAQV-SRSCMACHSFSPG-RHMTGPSLAGVWGRRAGTAAGFSRYSDALKRSEIVWT 86

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E +L  +L  P   IPG  M+F GI   G RADL+AYL+  +
Sbjct: 87  EKSLDAWLRKPAALIPGNTMLFDGIPDPGTRADLLAYLQAVS 128


Go to top
>tr|A9I4P1|A9I4P1_BORPD Putative cytochrome c.
          Length = 133

 Score = 98.6 bits (244), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G+ ++ ++C  CH +      +TGP   GLFGR+ G   GF Y++A K+ GI W 
Sbjct: 31  GDAMRGQSVY-ERCLACHAI---AYDRTGPRHCGLFGRRAGSVPGFDYSEAMKHSGIVWN 86

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           E TL  +L++P   +PGT M +AGI    ERADLIAYLK+A
Sbjct: 87  EQTLDVFLKSPMTAVPGTSMGYAGIPDPQERADLIAYLKQA 127


Go to top
>prf|3101377GCF|cytochrome c552
          Length = 168

 Score = 98.6 bits (244), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG+K+F +KCA CH V   G+  TGP+L G+ GR     AGF Y+ A +  G  W  
Sbjct: 70  DAAKGEKVF-KKCAACHKVN--GEDATGPHLDGVVGRAVASVAGFGYSGAMQGHGGDWTP 126

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + L E+L  P   +PGT M F+G+KK+G+R DLIAYL+  +N
Sbjct: 127 EALDEFLTKPSAAVPGTSMSFSGLKKQGDRVDLIAYLQSVSN 168


Go to top
>tr|Q5LMM5|Q5LMM5_SILPO Cytochrome c552.
          Length = 168

 Score = 98.6 bits (244), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG+K+F +KCA CH V   G+  TGP+L G+ GR     AGF Y+ A +  G  W  
Sbjct: 70  DAAKGEKVF-KKCAACHKVN--GEDATGPHLDGVVGRAVASVAGFGYSGAMQGHGGDWTP 126

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + L E+L  P   +PGT M F+G+KK+G+R DLIAYL+  +N
Sbjct: 127 EALDEFLTKPSAAVPGTSMSFSGLKKQGDRVDLIAYLQSVSN 168


Go to top
>prf|1311229A|cytochrome C2
          Length = 107

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (65%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F   C  CH  +  G++K GP+L+G+ GR +G   G++Y++AN   GI W 
Sbjct: 6   GDPVEGKHLFHTICILCHITDIKGRNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWT 65

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L +Y+E+P+K +PGTKM + G     +RAD+IAYL+
Sbjct: 66  PDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLE 104


Go to top
>prf|764652A|cytochrome c
          Length = 109

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+ IF  +C+ CH +E  G     P L G+ GRK GQ   F+Y+   K  GITW 
Sbjct: 12  GDASAGRDIFDSQCSACHAIE--GDSTAAPVLGGVIGRKAGQEK-FAYSKGMKGSGITWN 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L  +L+NP K++PGTKM FAG+    +RADLIAYLK
Sbjct: 69  EKHLFVFLKNPSKHVPGTKMAFAGLPADKDRADLIAYLK 107


Go to top
>sp|P00079|CYC_TETPY Cytochrome c.
          Length = 109

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+ IF  +C+ CH +E  G     P L G+ GRK GQ   F+Y+   K  GITW 
Sbjct: 12  GDASAGRDIFDSQCSACHAIE--GDSTAAPVLGGVIGRKAGQEK-FAYSKGMKGSGITWN 68

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L  +L+NP K++PGTKM FAG+    +RADLIAYLK
Sbjct: 69  EKHLFVFLKNPSKHVPGTKMAFAGLPADKDRADLIAYLK 107


Go to top
>tr|Q1LG27|Q1LG27_RALME Cytochrome c, class I precursor.
          Length = 129

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 63/100 (63%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +G+V+ GK+ F + CA CH V    +   GP L+G+FGRK G  A + Y+DA K   + W
Sbjct: 27  VGNVQTGKETFTRLCASCHRVGPSARGAFGPQLNGVFGRKAGSTADYRYSDAMKTSNVVW 86

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + TL  ++++P K +PGTKM F G+    + ADL+AYL+
Sbjct: 87  SDATLGAFVQSPGKVVPGTKMRFWGMSDPQQIADLLAYLR 126


Go to top
>tr|B0UNK8|B0UNK8_METS4 Cytochrome c class I precursor.
          Length = 179

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG+    +KCA CH  +KGG +K GPNL G+ GR  G   GF+Y+ A K KG  W  
Sbjct: 71  DAAKGQSA-AKKCAACHNFDKGGANKVGPNLWGVVGRPKGSHEGFNYSAAMKAKGGDWSY 129

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           + L +++ NPK Y+ GT M FAG+    ERAD++AYLK  +++
Sbjct: 130 EDLDQFIHNPKGYVQGTIMAFAGVSSGAERADILAYLKTLSDK 172


Go to top
>tr|Q92SX7|Q92SX7_RHIME PUTATIVE CYTOCHROME C TRANSMEMBRANE PROTEIN.
          Length = 259

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 64/103 (62%), Gaps = 5/103 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG----I 58
           D   G+ +F +KCA CHTVEKGG +K GPNL  +  R      GFSY+   +       +
Sbjct: 72  DASAGEGVF-KKCASCHTVEKGGPNKVGPNLWSVVNRPVASHEGFSYSAGMQTFAEGGKV 130

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W  D L  +LE PKK++PGT M FAGIKK  ERA+LIA+L++
Sbjct: 131 VWDYDHLSYFLEAPKKHVPGTAMGFAGIKKVDERANLIAWLRE 173


Go to top
>prf|3124366PD|cytochrome c2
          Length = 128

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E G K+F + C+ CH +    +   GP L+G+  R  G AA + Y+ A K+ GI W 
Sbjct: 25  GDAEAGAKLFKRLCSGCHNIGPSVRSSFGPQLNGIIDRPAGSAADYQYSTAMKSSGIVWS 84

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L++YLE+PK  +PGT+MIF G+  + +  +L+AYL+
Sbjct: 85  RDKLIQYLEDPKAVVPGTRMIFWGLSDEEKIDNLLAYLQ 123


Go to top
>tr|Q4KJW9|Q4KJW9_PSEF5 Cytochrome c2.
          Length = 128

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E G K+F + C+ CH +    +   GP L+G+  R  G AA + Y+ A K+ GI W 
Sbjct: 25  GDAEAGAKLFKRLCSGCHNIGPSVRSSFGPQLNGIIDRPAGSAADYQYSTAMKSSGIVWS 84

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L++YLE+PK  +PGT+MIF G+  + +  +L+AYL+
Sbjct: 85  RDKLIQYLEDPKAVVPGTRMIFWGLSDEEKIDNLLAYLQ 123


Go to top
>tr|Q0ANL0|Q0ANL0_MARMM Cytochrome c, class I precursor.
          Length = 166

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D+  G + F ++C  CHT++ GG+H  GPNLH + GR    A  FS++   ++ G+TW 
Sbjct: 63  ADLANGARQF-RRCQSCHTLDAGGRHTVGPNLHRIIGRPAAIADRFSFSSQLEDAGLTWD 121

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            +TL  ++ NP+  +PG +M F G++   +R DLIAY+
Sbjct: 122 LETLDAWIANPRALVPGNRMSFVGLRNPEDRRDLIAYI 159


Go to top
>tr|A8TYT8|A8TYT8_9PROT Cytochrome c.
          Length = 161

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI--- 58
           GD   GK +F +KC  CHTV+   KH+ GP+L G+ GR  G + GF ++DA K  G    
Sbjct: 57  GDSAAGKTVF-RKCVACHTVQ-ANKHRIGPSLAGIAGRTAGTSEGFKFSDAMKAFGADGK 114

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            W + TL  YL +PK  + GTKM FAG+K   +RAD+IAYLK A  E
Sbjct: 115 IWDDATLDAYLADPKGVVKGTKMAFAGLKDAQDRADVIAYLKAANGE 161


Go to top
>tr|A6UF14|A6UF14_SINMW Cytochrome c class I precursor.
          Length = 263

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 5/106 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA----NKNKGI 58
           D   G+ +F +KCA CHTVEKGG +K GPNL  +  R      GFSY+      ++   +
Sbjct: 72  DAPAGEAVF-KKCASCHTVEKGGPNKVGPNLWDIVNRPIASHEGFSYSAGMQTFSEGGKV 130

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            W  D L  +LE PKK++PGT M FAG+KK  ERA+LIA+L++ ++
Sbjct: 131 VWDYDHLSYFLEAPKKHVPGTAMGFAGLKKTDERANLIAWLREHSD 176


Go to top
>tr|A1B9M7|A1B9M7_PARDP Sulfide dehydrogenase (Flavocytochrome),
           cytochrome c subunit precursor (EC 1.-.-.-).
          Length = 236

 Score = 97.1 bits (240), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 3/107 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD  +G ++F ++C+ CH +  G    TGP L+G+FGR+ G  AGF+Y+ A     N G
Sbjct: 26  IGDPLRGAELFAEECSACHRIGPGATDATGPRLNGIFGRRAGSLAGFNYSRAMLRMGNDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + W   TL  Y+ENPK  + GT+M + G+     R DL+AYL+  ++
Sbjct: 86  LRWTLPTLDAYIENPKALVSGTRMAYRGLADAQARGDLMAYLRAYSD 132


Go to top
>sp|P00089|CYC22_RHOFU Cytochrome c2 iso-2.
          Length = 96

 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 59/87 (67%), Gaps = 1/87 (1%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           C  CH+VE  GK+  GP+L G++GRK G  AGF ++D +   G+TW E TL +YL +PK 
Sbjct: 10  CKACHSVE-AGKNGVGPSLAGVYGRKAGTLAGFKFSDPHAKSGLTWDEPTLTKYLADPKG 68

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLKK 101
            IPG KM+FAG+K   + A +IAYLK 
Sbjct: 69  VIPGNKMVFAGLKNPADVAAVIAYLKS 95


Go to top
>prf|3210325AGX|cytochrome c
          Length = 173

 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAG-FSYTDANKNKGITW 60
            D+ KGK+I  +KC  CHT EKGG ++ GPNL  + G K       F+Y+ A  NKG TW
Sbjct: 72  ADITKGKEI-TKKCISCHTFEKGGANRVGPNLWNIIGNKKAHLGDKFNYSKAMLNKGGTW 130

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               L E+L  P+ YI GT+M FAGI K  + ADLIAYLK
Sbjct: 131 EHQDLFEFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLK 170


Go to top
>tr|Q3YRE5|Q3YRE5_EHRCJ Cytochrome c, class I.
          Length = 173

 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 62/100 (62%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAG-FSYTDANKNKGITW 60
            D+ KGK+I  +KC  CHT EKGG ++ GPNL  + G K       F+Y+ A  NKG TW
Sbjct: 72  ADITKGKEI-TKKCISCHTFEKGGANRVGPNLWNIIGNKKAHLGDKFNYSKAMLNKGGTW 130

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               L E+L  P+ YI GT+M FAGI K  + ADLIAYLK
Sbjct: 131 EHQDLFEFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLK 170


Go to top
>tr|B0T1L4|B0T1L4_CAUSK Cytochrome c class I.
          Length = 165

 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD+  G+  F   C  CHT+ +GG + TGPNL+G+FGRK G    + Y+      G  W 
Sbjct: 58  GDLLNGQSKFAL-CRSCHTITQGGPNMTGPNLYGVFGRKAGGKPDYQYSPVVAAAGFDWD 116

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            + L ++L+NP+ ++PGTKM FAG+    +R DLIAYLK  T
Sbjct: 117 AEHLDKWLDNPRGFMPGTKMTFAGLHDPKDRIDLIAYLKVET 158


Go to top
>tr|A9GDV5|A9GDV5_METNO Cytochrome c, class I precursor.
          Length = 180

 Score = 96.7 bits (239), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG+    +KCA CH+ +KGG +K GPNL G+ GR  G   GF+Y+ A K KG  W  
Sbjct: 72  DAAKGQSA-AKKCAACHSFDKGGPNKVGPNLWGIVGRPKGSHEGFNYSAAMKAKGGDWSY 130

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           D L  ++  PK ++ GT M FAG+    ERAD++AYLK  +++
Sbjct: 131 DDLDHFIHAPKGFVSGTIMAFAGVPSGAERADILAYLKTLSDK 173


Go to top
>tr|Q2GLE8|Q2GLE8_ANAPZ Cytochrome C, membrane-bound.
          Length = 174

 Score = 96.7 bits (239), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 66/101 (65%), Gaps = 2/101 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           EKGK +  +KC+ CHT  KGG H+ GPNL G+ G K  +A  F Y+ A  +KG TW E+ 
Sbjct: 74  EKGKAV-AKKCSACHTFNKGGPHRVGPNLWGVVGSKQARAQDFPYSKALLSKGGTWSEEE 132

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           L ++L++P+ Y  GT+M FAG+K K + AD++AY K    E
Sbjct: 133 LFKFLDSPRNYANGTRMAFAGLKPK-DIADVLAYFKSLEKE 172


Go to top
>tr|A3W514|A3W514_9RHOB Diheme cytochrome c SoxE.
          Length = 234

 Score = 96.7 bits (239), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 66/103 (64%), Gaps = 4/103 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI--- 58
           GD   G+ ++ Q C  CH + +G + + GP+L+GLFGR+     GF+Y+D+ +  G+   
Sbjct: 26  GDTAAGEALYGQ-CKGCHEIGQGAEDRIGPHLNGLFGRRAASHTGFAYSDSMQRAGVDGL 84

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            WG DTL  Y+ENP+  +  T+M F GIK   +RADL+AYL++
Sbjct: 85  IWGFDTLDAYIENPRALVSKTRMSFRGIKDAQDRADLLAYLRR 127


Go to top
>tr|A3JR05|A3JR05_9RHOB Cytochrome c family protein.
          Length = 126

 Score = 96.3 bits (238), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD++KGKK+F +KCA CH V +  K KTGP L+G+ G K GQAA F Y+         G+
Sbjct: 23  GDIDKGKKVF-KKCAACHMVGENAKKKTGPVLNGVVGAKAGQAADFRYSKVLTRMAEDGL 81

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E +L  +L  PKK++ GTKM F G++K+ + A++IAYL
Sbjct: 82  VWDEASLTAFLAGPKKFMKGTKMSFKGLRKETDIANVIAYL 122


Go to top
>tr|A6UGH4|A6UGH4_SINMW Cytochrome c class I precursor.
          Length = 136

 Score = 96.3 bits (238), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 63/94 (67%), Gaps = 4/94 (4%)

Query: 9   KIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGEDTL 65
           K+F +KC  CHTV    K KTGP L+G+ GR  G+  G++Y+ A       G+TW  + +
Sbjct: 40  KVF-RKCQACHTVGPDAKSKTGPLLNGIIGRSAGKVEGYAYSPAIEKAAEAGLTWTPEKI 98

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            E+L +PK ++PGTKM FAG++K  ERAD+IAYL
Sbjct: 99  AEFLTSPKGFLPGTKMTFAGLRKDQERADIIAYL 132


Go to top
>sp|P00080|CYC2_RHOGL Cytochrome c2.
          Length = 106

 Score = 95.9 bits (237), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F   C  CHT  KG ++K GP+L+G+ GR +G   G++Y++AN   GI W 
Sbjct: 6   GDPVEGKHLFHTICILCHTDIKG-RNKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L +Y+E+P+K +PGTKM + G     +RAD+IAYL+
Sbjct: 65  PDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLE 103


Go to top
>tr|A4G566|A4G566_HERAR Putative Cytochrome c.
          Length = 136

 Score = 95.9 bits (237), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (63%), Gaps = 4/99 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           V+ G+ I+  +C  CH +      +TGP   GLFGR+ G   GF+Y+DA K+  I W E 
Sbjct: 34  VKAGEAIYA-RCLACHAL---AYDRTGPRHCGLFGRRAGSVKGFNYSDAMKHSNIVWNEK 89

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
           TL  +L NP K +PGT M +AG+  + ER+DLI+YLK+A
Sbjct: 90  TLNLFLSNPTKTVPGTTMTYAGVTSQKERSDLISYLKQA 128


Go to top
>tr|Q2GB57|Q2GB57_NOVAD Cytochrome c, class I.
          Length = 296

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 2/96 (2%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT-GQAAGFSYTDANKNKGITWGEDT 64
           KG+ IF  KC  CHT+++GG +  GPNL  ++G K  G+  GF+++DA K KG TW + T
Sbjct: 199 KGEAIFA-KCKACHTIDQGGANGIGPNLFAVYGEKVAGERGGFAFSDALKGKGGTWDDAT 257

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           L  +L +P K+  GTKM FAGI    +RAD+IAY+K
Sbjct: 258 LDAWLTSPAKFAQGTKMTFAGIADAQQRADVIAYMK 293



Go to top
 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA-AGFSYTDANKNKGITWG 61
           DV+ G+ +F  KC  CHT E+GG +  GPNL+G+ G        GF+++DA K KG  W 
Sbjct: 70  DVKAGEALFA-KCKACHTAEQGGANGIGPNLYGVVGEAVAAGRGGFAFSDALKAKGGKWD 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            ++L  +L+NPK Y  GTKM FAG+ K  +RA++I YL
Sbjct: 129 FESLDAWLKNPKAYADGTKMSFAGLPKGEDRANVIVYL 166


Go to top
>tr|Q2GA61|Q2GA61_NOVAD Cytochrome c, class I precursor.
          Length = 149

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   GKK+F+ +C  CH V+     K GPNL G+ GRK G AA F Y+ A K   + W 
Sbjct: 49  GDPVLGKKVFM-RCVACHAVQPNAPMKMGPNLAGVVGRKAG-AANFKYSAAMKKANVKWD 106

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E TL ++L  P   +PGT M FAG+    ERA +IAYLKK
Sbjct: 107 EATLDKWLLKPSAVVPGTSMAFAGVPNAEERAAVIAYLKK 146


Go to top
>tr|Q1GVI0|Q1GVI0_SPHAL Cytochrome c, class I precursor.
          Length = 212

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG+ +F  KCA CHT+  GG +  GPNL+G  G+  G   GF+Y++A K+    W  
Sbjct: 66  DPAKGEAVFA-KCAACHTINAGGANGIGPNLYGALGKAHGHVPGFAYSEALKSVPGNWDF 124

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            ++ E+L++P+KY PGTKM FAG+    +RA+LI Y+ 
Sbjct: 125 ASMDEWLKSPRKYAPGTKMSFAGLSSPEDRANLIVYMN 162


Go to top
>pdb|1HRO_B|2.2 | 2| 106|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2;
           CHAIN: A, B       
          Length = 106

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F   C  CHT  KG  +K GP+L+G+ GR +G   G++Y++AN   GI W 
Sbjct: 6   GDPVEGKHLFHTICITCHTDIKGA-NKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L +Y+E+P+K +PGTKM + G     +RAD+IAYL+
Sbjct: 65  PDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLE 103


Go to top
>pdb|1HRO_A|2.2 | 2| 106|N|MOL_ID: 1; MOLECULE: CYTOCHROME C2;
           CHAIN: A, B       
          Length = 106

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F   C  CHT  KG  +K GP+L+G+ GR +G   G++Y++AN   GI W 
Sbjct: 6   GDPVEGKHLFHTICITCHTDIKGA-NKVGPSLYGVVGRHSGIEPGYNYSEANIKSGIVWT 64

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            D L +Y+E+P+K +PGTKM + G     +RAD+IAYL+
Sbjct: 65  PDVLFKYIEHPQKIVPGTKMGYPGQPDPQKRADIIAYLE 103


Go to top
>tr|A1WBY7|A1WBY7_ACISJ Cytochrome c, class I.
          Length = 158

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITWGE 62
           + +G++I+  +CA CH +E    H+TGP   GLFGR++G A GF  Y+ A K  GI W E
Sbjct: 26  LARGQQIYA-RCAGCHAIEG---HRTGPQHCGLFGRRSGTAPGFDGYSPAMKASGIVWDE 81

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            TL  +L++P   +PGT M +AG+K  GERA LIA+L+ 
Sbjct: 82  RTLQRFLKDPPATVPGTSMGYAGVKDDGERAALIAWLRS 120


Go to top
>tr|Q0JYS2|Q0JYS2_RALEH Cytochrome c2 precursor.
          Length = 125

 Score = 95.1 bits (235), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 60/98 (61%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D++ GK +F  +CA CH V +  +   GP L+G+FGR  G  + F Y++A +   + W  
Sbjct: 25  DIQAGKALFATRCASCHHVGRNARAGFGPQLNGIFGRAAGGTSDFQYSEAMRASKVVWSH 84

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           DTL  ++ +P K +PGTKM F G+    + +DL+AYL+
Sbjct: 85  DTLRAFIHSPGKVVPGTKMRFWGLSDDKQISDLLAYLQ 122


Go to top
>tr|Q1N9K5|Q1N9K5_9SPHN Cytochrome c, class I.
          Length = 222

 Score = 95.1 bits (235), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%), Gaps = 2/99 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQA-AGFSYTDANKNKGITWG 61
           DV  G+K+F  KCA CHTV +GG +  GPNL G  G       AGF+++DA K+KG  W 
Sbjct: 66  DVAAGEKVFA-KCAACHTVNQGGANGIGPNLWGTVGEAIAVGKAGFAFSDALKSKGGQWT 124

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + +  +L++P+++ PGTKM FAG+    +RA+LIA+L 
Sbjct: 125 FENMDAWLKSPREFAPGTKMTFAGLGNPADRANLIAWLN 163


Go to top
>prf|3311449BAA|cytochrome c
          Length = 182

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             +E G K+F QKC+ CHT  K G ++ GPNL+ +  R       ++Y+ A  ++G +W 
Sbjct: 79  ASLESGSKLFKQKCSSCHTSNKDGVNRVGPNLYDVVNRIKATYPNYNYSAAMTSQGGSWD 138

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E +L  YL  P KYIPGT+M F G+    + AD+I +LK+ TN+
Sbjct: 139 EKSLFLYLHKPTKYIPGTRMSFIGLPNAKDIADVIKFLKENTNK 182


Go to top
>tr|A5CF41|A5CF41_ORITB Cytochrome c.
          Length = 182

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             +E G K+F QKC+ CHT  K G ++ GPNL+ +  R       ++Y+ A  ++G +W 
Sbjct: 79  ASLESGSKLFKQKCSSCHTSNKDGVNRVGPNLYDVVNRIKATYPNYNYSAAMTSQGGSWD 138

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           E +L  YL  P KYIPGT+M F G+    + AD+I +LK+ TN+
Sbjct: 139 EKSLFLYLHKPTKYIPGTRMSFIGLPNAKDIADVIKFLKENTNK 182


Go to top
>prf|3101377GXQ|cytochrome c family protein
          Length = 125

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 4/102 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD +KGKK+F  KC  CH V +G  +K GP L+G+ G   GQ  GF Y+DA       G+
Sbjct: 23  GDADKGKKVF-NKCKACHAVGEGAANKVGPQLNGIIGAAAGQVEGFKYSDALIEAAAGGL 81

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            W +++L  +L  PK ++ GTKM FAG+KK+ E  ++IAYL+
Sbjct: 82  VWDDESLAAFLAKPKDFMKGTKMSFAGLKKEDEIENVIAYLQ 123


Go to top
>tr|Q5LLH2|Q5LLH2_SILPO Cytochrome c family protein.
          Length = 125

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 4/102 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD +KGKK+F  KC  CH V +G  +K GP L+G+ G   GQ  GF Y+DA       G+
Sbjct: 23  GDADKGKKVF-NKCKACHAVGEGAANKVGPQLNGIIGAAAGQVEGFKYSDALIEAAAGGL 81

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            W +++L  +L  PK ++ GTKM FAG+KK+ E  ++IAYL+
Sbjct: 82  VWDDESLAAFLAKPKDFMKGTKMSFAGLKKEDEIENVIAYLQ 123


Go to top
>tr|B2IDY2|B2IDY2_9RHIZ Cytochrome c class I precursor.
          Length = 179

 Score = 94.0 bits (232), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV+KG+    + C  CHT EKGG  K GP L G+  R  G  AGFSY+DA K KG  W 
Sbjct: 70  ADVKKGEAD-TKPCQACHTFEKGGAAKVGPPLWGIVDRAKGSIAGFSYSDALKAKGGEWT 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            D L  ++ +PK ++ GTKM F G K   +RADLI YL   ++E
Sbjct: 129 YDDLDAFITSPKSFVSGTKMAFGGEKDPQKRADLIDYLHTLSDE 172


Go to top
>tr|Q2G7L0|Q2G7L0_NOVAD Cytochrome c, class I precursor.
          Length = 124

 Score = 94.0 bits (232), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F  +CA CH +  G   + GP+L G+ GR +G    F+Y+ A K+K + W 
Sbjct: 24  GDAVRGKAVFA-RCAACHDLNTGAT-RLGPSLKGVVGRTSGTMPNFNYSQAMKDKAVVWN 81

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
             TL  YL  P KYIPG +M F  +    +RADL+A+L+++
Sbjct: 82  ATTLDAYLAGPAKYIPGNRMAFPPLTNPQDRADLVAFLQQS 122


Go to top
>tr|Q92MU4|Q92MU4_RHIME PUTATIVE CYTOCHROME C TRANSMEMBRANE PROTEIN.
          Length = 128

 Score = 94.0 bits (232), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 66/103 (64%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD E G  +F +KCA CH ++K  ++K GP+L G+ GR  G  A F Y+ A  + G   +
Sbjct: 25  GDAEAGATVF-KKCATCHVIDKD-QNKVGPSLQGVIGRTAGTHADFKYSQAMIDAGKGGL 82

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W + TL EYL NP+  + GTKM+F G+KK  E A++IAYLK+
Sbjct: 83  VWDDATLAEYLRNPRAKVKGTKMVFPGLKKDEEIANVIAYLKQ 125


Go to top
>tr|A3JWK3|A3JWK3_9RHOB Cytochrome c family protein.
          Length = 127

 Score = 94.0 bits (232), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 66/104 (63%), Gaps = 4/104 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGI 58
            D+++GKK+F +KC  CHT+ +G  +KTGP L G+ G   G   GF Y+    A    G+
Sbjct: 24  ADIDRGKKVF-RKCKACHTIGEGATNKTGPILTGIMGVPAGVVEGFQYSSELRAAAEIGL 82

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
            W + +L E+L  P+K+IPGTKM F+G++K  + ++LI +L+  
Sbjct: 83  VWDDASLTEFLRKPRKFIPGTKMSFSGLRKDQDISNLIDFLRSV 126


Go to top
>tr|A3UFM2|A3UFM2_9RHOB Cytochrome c, membrane-bound.
          Length = 246

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 64/103 (62%), Gaps = 4/103 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT-- 59
            DV  G+++  ++CA CHT + G    TGP+L+G+ GR      GF+Y+ A +    T  
Sbjct: 71  ADVSAGERV-ARRCASCHTFDSGMADGTGPHLYGVLGRAVAAVDGFNYSGAMQEYATTTS 129

Query: 60  -WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W  + L  +LENP++YIPGT M FAG++ + +R +LIAY+ +
Sbjct: 130 DWHYENLYNFLENPRRYIPGTAMSFAGLRDQEDRINLIAYIHE 172


Go to top
>tr|Q7WLB0|Q7WLB0_BORBR Putative cytochrome c.
          Length = 136

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  +G++++  +C  CH +      + GP   GL GRK G   GF+YT A K+ G+TW  
Sbjct: 28  DPVRGEQVYA-RCLACHAL---AYDRVGPRHCGLLGRKAGSVPGFAYTQAMKDSGLTWDA 83

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            TL  +L +P K +PGT M +AG+   GERADLIAYL+
Sbjct: 84  ATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYLR 121


Go to top
>tr|Q7VX17|Q7VX17_BORPE Putative cytochrome c.
          Length = 136

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  +G++++  +C  CH +      + GP   GL GRK G   GF+YT A K+ G+TW  
Sbjct: 28  DPVRGEQVYA-RCLACHAL---AYDRVGPRHCGLLGRKAGSVPGFAYTQAMKDSGLTWDA 83

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            TL  +L +P K +PGT M +AG+   GERADLIAYL+
Sbjct: 84  ATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYLR 121


Go to top
>tr|B1M1Z4|B1M1Z4_METRJ Cytochrome c class I precursor.
          Length = 121

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (60%), Gaps = 4/99 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+K F   C  CH  +K G    GP+L G+ GRK G   G++Y+ A KN GITW 
Sbjct: 24  GDAAAGEKAFA-PCKACHNFQKNG---VGPDLKGVVGRKAGTYEGYNYSAALKNSGITWD 79

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L E+L+NPK  +PG KMIF GI    +  DLIAYLK
Sbjct: 80  EANLHEWLKNPKAKVPGNKMIFQGIADDKKINDLIAYLK 118


Go to top
>tr|B0UGW3|B0UGW3_METS4 Cytochrome c class I precursor.
          Length = 122

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+K F   C  CH     GK+  GPNL G+ GRK+    G+SY+ A K  GITW 
Sbjct: 24  GDPAAGEKAFAT-CKACHAF---GKNGVGPNLTGVVGRKSASVEGYSYSAALKGSGITWD 79

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           E  L E+L+NPK  +PGTKMIFAG     +  D+IAYLK+ T
Sbjct: 80  EANLHEWLKNPKAKVPGTKMIFAGYPDDKKVDDVIAYLKQHT 121


Go to top
>tr|A6E560|A6E560_9RHOB Diheme cytochrome c SoxE.
          Length = 234

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 4/104 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI-- 58
           +GD E G+ ++ Q C  CH + KG + + GP+L+GLFGR+     GF+Y+ + +  G+  
Sbjct: 25  VGDAEAGETLYGQ-CKGCHEIGKGAEDRIGPHLNGLFGRRVASHEGFAYSASMQRAGVDG 83

Query: 59  -TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             WG DTL  Y+ENP+  +  T+M + G+K   +RADL+AYL++
Sbjct: 84  LIWGFDTLDAYIENPRALVSKTRMSYRGMKDAQDRADLMAYLRR 127


Go to top
>prf|1712131A|cytochrome c550
          Length = 109

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGITWGE 62
           KG  +F  KC  CH V +G K+K GP L+G+ GRK G   GF+Y+D  K    KG  W  
Sbjct: 5   KGANVF-WKCMACHAVGEGAKNKVGPELNGIIGRKMGSIEGFNYSDTLKEHNAKGDVWTA 63

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L +YL NPK Y+PG KM+FAG+ K+    DL AYLK
Sbjct: 64  EILSQYLANPKGYMPGVKMVFAGLPKEIRADDLEAYLK 101


Go to top
>sp|P23021|CY550_THINO Cytochrome c-550 (Cytochrome c550)
           (Fragment).
          Length = 107

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGITWGE 62
           KG  +F  KC  CH V +G K+K GP L+G+ GRK G   GF+Y+D  K    KG  W  
Sbjct: 3   KGANVF-WKCMACHAVGEGAKNKVGPELNGIIGRKMGSIEGFNYSDTLKEHNAKGDVWTA 61

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L +YL NPK Y+PG KM+FAG+ K+    DL AYLK
Sbjct: 62  EILSQYLANPKGYMPGVKMVFAGLPKEIRADDLEAYLK 99


Go to top
>tr|A1B9M6|A1B9M6_PARDP Sulfur dehydrogenase subunit SoxD precursor
           (EC 1.-.-.-).
          Length = 382

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 65/99 (65%), Gaps = 4/99 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITW 60
           V  G+K+F +KC  CH + +G K+ TGP L+G+ GR  G+  GF Y+    A  + G+ W
Sbjct: 280 VAAGEKVF-KKCTACHKLGEGAKNGTGPLLNGIVGRPAGEIEGFKYSKPLLAMASDGLVW 338

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            +  L  +LENPK ++ GTKM FAG+KK+ ERA +IAYL
Sbjct: 339 DDAALHAFLENPKGFMKGTKMSFAGLKKEDERAAVIAYL 377


Go to top
>tr|B1TMR9|B1TMR9_METSI Cytochrome c class I precursor.
          Length = 182

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV++G+ +  + C  CH+ EKGG  K GP L G+ GR     AGF Y+DA K KG  W  
Sbjct: 72  DVKRGESL-TKACQACHSFEKGGAAKVGPPLFGVVGRPKDSIAGFGYSDAMKAKGGAWTF 130

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           D L  ++ +PK +I GTKM FAG     +RAD+IAYL+  ++ 
Sbjct: 131 DDLDHFIASPKGFISGTKMGFAGEPDPQKRADIIAYLRTLSDS 173


Go to top
>prf|2319288E|cytochrome
          Length = 236

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD   G  +F ++CA CH + +  ++  GP L+G+FGR+    A F+Y+ A K   N G
Sbjct: 26  IGDTVHGAVLFRKECAICHRIGQDARNAVGPRLNGVFGRRAAALADFNYSRAMKRKGNDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +TW  +TL  Y+ENPK  + GT+M + G+     RADL+AY++  ++
Sbjct: 86  LTWTLETLDAYIENPKALVTGTRMSYRGLADPQARADLMAYMRDHSD 132


Go to top
>tr|A3KAU5|A3KAU5_9RHOB Cytochrome c family protein.
          Length = 134

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI--- 58
           GD +KG+++F +KC  CH V +  K+K GP L+G+ GR       F+Y+D  K  G    
Sbjct: 28  GDAKKGERVF-RKCQACHAVGEDAKNKVGPVLNGVVGRPVASVEDFAYSDTLKEMGAEGK 86

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           TW  + L  +LE P+ Y  GTKM FAG++K+ ERAD+IA+L
Sbjct: 87  TWTPEDLAAFLEKPRDYAKGTKMAFAGLRKEEERADVIAFL 127


Go to top
>tr|A3SHJ5|A3SHJ5_9RHOB Putative uncharacterized protein.
          Length = 245

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV +G+KIF +KC  CHTVEK GK ++GPNL+ + G       GF Y+ A    G  W 
Sbjct: 35  ADVAEGEKIF-RKCKACHTVEKDGKSRSGPNLYDIVGGPVAAREGFKYSGALSEYGGAWS 93

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            + L  +LE PK  + GT+M F G+KK  +RA LIAYL   + E
Sbjct: 94  PERLDAFLEKPKDEVKGTRMSFPGLKKPEDRAALIAYLASHSEE 137


Go to top
>tr|A3VSC6|A3VSC6_9PROT Cytochrome c, class I.
          Length = 149

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
            +KG  +F ++C  CH  +KGG+H  GPNL G+ G    Q   F+Y+ A +  G+ W ED
Sbjct: 38  AQKGLTLF-RECGVCHNYQKGGRHGVGPNLWGVVGAPAAQRDTFAYSRALERSGLIWTED 96

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           TL  YLENP + +PGT+M + G+    +R  LIA+L  
Sbjct: 97  TLDRYLENPHEVVPGTRMAYRGMADPADRDALIAFLAS 134


Go to top
>prf|2619324L|cytochrome
          Length = 236

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD   G  +F ++CA CH + +  ++  GP L+G+FGR+    A F+Y+ A K   N G
Sbjct: 26  IGDTVHGAVLFRKECAICHRIGQDARNAVGPRLNGVFGRRAAALADFNYSRAMKRKGNDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +TW  +TL  Y+ENPK  + GT+M + G+     RADL+AY++  ++
Sbjct: 86  LTWTLETLDAYIENPKALVTGTRMSYRGLADPQARADLMAYMRDHSD 132


Go to top
>prf|2619324K|cytochrome
          Length = 384

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWGE 62
           +G+K+F +KCA CH V    K+ TGP L+G+ GR  G   GF Y+    A  ++G+ W +
Sbjct: 284 EGEKVF-KKCAACHKVGDDAKNGTGPLLNGIVGRAAGDIEGFKYSKPLLAMASEGLVWDD 342

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            +L  +LENPK ++ GTKM FAG+KK+ ERA +IAYL
Sbjct: 343 ASLHAFLENPKGFMKGTKMSFAGLKKEDERAAVIAYL 379


Go to top
>prf|2319288D|cytochrome
          Length = 384

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWGE 62
           +G+K+F +KCA CH V    K+ TGP L+G+ GR  G   GF Y+    A  ++G+ W +
Sbjct: 284 EGEKVF-KKCAACHKVGDDAKNGTGPLLNGIVGRAAGDIEGFKYSKPLLAMASEGLVWDD 342

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            +L  +LENPK ++ GTKM FAG+KK+ ERA +IAYL
Sbjct: 343 ASLHAFLENPKGFMKGTKMSFAGLKKEDERAAVIAYL 379


Go to top
>tr|O33435|O33435_PARDE Cytochrome.
          Length = 236

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD   G  +F ++CA CH + +  ++  GP L+G+FGR+    A F+Y+ A K   N G
Sbjct: 26  IGDTVHGAVLFRKECAICHRIGQDARNAVGPRLNGVFGRRAAALADFNYSRAMKRKGNDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +TW  +TL  Y+ENPK  + GT+M + G+     RADL+AY++  ++
Sbjct: 86  LTWTLETLDAYIENPKALVTGTRMSYRGLADPQARADLMAYMRDHSD 132


Go to top
>tr|O07819|O07819_PARDE Cytochrome.
          Length = 384

 Score = 93.2 bits (230), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWGE 62
           +G+K+F +KCA CH V    K+ TGP L+G+ GR  G   GF Y+    A  ++G+ W +
Sbjct: 284 EGEKVF-KKCAACHKVGDDAKNGTGPLLNGIVGRAAGDIEGFKYSKPLLAMASEGLVWDD 342

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            +L  +LENPK ++ GTKM FAG+KK+ ERA +IAYL
Sbjct: 343 ASLHAFLENPKGFMKGTKMSFAGLKKEDERAAVIAYL 379


Go to top
>prf|2723301K|flavocytochrome c
          Length = 238

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 4/107 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD  +G +I++  C+ CH +  G +   GP L+GLFGR+    A F Y+ + +   + G
Sbjct: 28  IGDPVRGAEIWIY-CSGCHEIGPGAQASIGPPLNGLFGRRAASVADFPYSKSMRRAGDDG 86

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +TW  +TL  YLENP   + GT+M F G++   ERADL+A+L++ ++
Sbjct: 87  LTWTLETLDAYLENPVVLVSGTRMSFPGLEDAAERADLLAFLRRYSD 133


Go to top
>tr|Q939T7|Q939T7_RHOSU Flavocytochrome c cytochrome subunit.
          Length = 238

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 4/107 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKG 57
           +GD  +G +I++  C+ CH +  G +   GP L+GLFGR+    A F Y+ + +   + G
Sbjct: 28  IGDPVRGAEIWIY-CSGCHEIGPGAQASIGPPLNGLFGRRAASVADFPYSKSMRRAGDDG 86

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +TW  +TL  YLENP   + GT+M F G++   ERADL+A+L++ ++
Sbjct: 87  LTWTLETLDAYLENPVVLVSGTRMSFPGLEDAAERADLLAFLRRYSD 133


Go to top
>tr|Q46VJ6|Q46VJ6_RALEJ Cytochrome c, class I.
          Length = 154

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 59/98 (60%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D++ GK +F  +CA CH+V    +   GP L+ +FGR+ G  + + Y+ A    G+ W  
Sbjct: 54  DIQAGKALFATRCASCHSVGPSARGAFGPQLNAVFGRRAGSTSDYRYSPAMTASGVVWTA 113

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           DTL  ++++P K +PGT+M F GI    +  DL+AYL+
Sbjct: 114 DTLRAFIKSPGKVVPGTRMRFWGIGNDQQIDDLLAYLQ 151


Go to top
>tr|A9VZK9|A9VZK9_METEX Cytochrome c class I precursor.
          Length = 305

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D EKGK    + C  CH+ EKGG +K GP+L  +  R+   AAGF Y+ A K KG TW  
Sbjct: 71  DAEKGKG-GTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAALKEKGGTWTY 129

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L  +LE+PK Y+ GTKM FAGI    +RA++IAYL+
Sbjct: 130 EDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLR 167


Go to top
>tr|A7W3Y2|A7W3Y2_METCH Cytochrome c, class I precursor.
          Length = 305

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D EKGK    + C  CH+ EKGG +K GP+L  +  R+   AAGF Y+ A K KG TW 
Sbjct: 70  ADAEKGKG-GTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAALKEKGGTWT 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  +LE+PK Y+ GTKM FAGI    +RA++IAYL+
Sbjct: 129 YEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLR 167


Go to top
>tr|A3KAW5|A3KAW5_9RHOB WD domain/cytochrome c family protein.
          Length = 426

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           +  G++ F++KC+ CH +E G   K GP LHG+FGR+ G   G++Y+D      I W +D
Sbjct: 317 MSNGERQFMRKCSICHALEPGPSRKAGPTLHGVFGRQAGTVPGYTYSDTLDGSDIVWTDD 376

Query: 64  TL-MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           T+   + + P  YIPG+KM    I    +RADLIA+LK A +
Sbjct: 377 TIDALFDQGPDHYIPGSKMPMQVIAGADDRADLIAFLKSAND 418


Go to top
>tr|Q0FS91|Q0FS91_9RHOB WD domain/cytochrome c family protein.
          Length = 436

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL- 65
           G++ F++KC+ CH +  G   K GP+LHG+FGR+ G   G+SY+D      I W E T+ 
Sbjct: 331 GERQFMRKCSICHALSPGPSRKAGPSLHGVFGRRAGTVPGYSYSDTLDGSDIVWTETTID 390

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             + + P  YIPG+KM    I   G+RADLI YLK+A+
Sbjct: 391 ALFDQGPDHYIPGSKMPMQVIAGGGDRADLIDYLKRAS 428


Go to top
>prf|3302410BWA|cytochrome c2
          Length = 234

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 69/106 (65%), Gaps = 4/106 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGIT 59
           D +KG+++F Q CA CH V +G ++  GP+L+G+FGR  G+  G  Y+ +     N G+ 
Sbjct: 27  DADKGREVFRQ-CAFCHAVGEGAENGIGPHLNGVFGRAAGRIEGVQYSKSMIRMGNDGLI 85

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           W   TL  Y+ENP+  +  T+M F GIK + ER+DL+AYL++ +++
Sbjct: 86  WTAQTLDAYIENPRALVSKTRMSFRGIKNEQERSDLMAYLRRYSDD 131


Go to top
>tr|Q16A42|Q16A42_ROSDO Cytochrome c2.
          Length = 234

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 69/106 (65%), Gaps = 4/106 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGIT 59
           D +KG+++F Q CA CH V +G ++  GP+L+G+FGR  G+  G  Y+ +     N G+ 
Sbjct: 27  DADKGREVFRQ-CAFCHAVGEGAENGIGPHLNGVFGRAAGRIEGVQYSKSMIRMGNDGLI 85

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           W   TL  Y+ENP+  +  T+M F GIK + ER+DL+AYL++ +++
Sbjct: 86  WTAQTLDAYIENPRALVSKTRMSFRGIKNEQERSDLMAYLRRYSDD 131


Go to top
>tr|A7HPP0|A7HPP0_PARL1 Cytochrome c class I precursor.
          Length = 220

 Score = 92.8 bits (229), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI-TW 60
            D+ +G++   +KC  CHT E+GG  + GPNL+G+ G     A GF+Y+ A + K    W
Sbjct: 70  ADIGRGERA-SKKCTACHTFEEGGPARIGPNLYGIVGNTHAHAPGFAYSAAMQAKSSEPW 128

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             + L  ++ +P+ Y+PGT M FAGIKK  ERADL+ YL  
Sbjct: 129 SFEELDHFITDPRGYLPGTAMSFAGIKKPQERADLLVYLNS 169


Go to top
>tr|A9HMM1|A9HMM1_METNO Cytochrome c precursor.
          Length = 118

 Score = 92.8 bits (229), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 4/94 (4%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+K+F Q C  CH     GK+  GP+L G  GRK G   G++Y+ A K+ G+TW E TL 
Sbjct: 26  GEKLFAQ-CKACHAF---GKNGVGPDLKGTVGRKAGTHEGYNYSAALKDSGLTWDEATLH 81

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           ++L NPK  +PGTKMI+AG+K + + +DLIAYLK
Sbjct: 82  KWLANPKGLVPGTKMIYAGLKDEKKVSDLIAYLK 115


Go to top
>tr|A6FWD1|A6FWD1_9RHOB Sulfur oxidation protein SoxY.
          Length = 234

 Score = 92.8 bits (229), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 5/104 (4%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAG-FSYTDANKN---K 56
           +GD E+GK +F   C+ CH V +G ++  GP+L+G+FGRK G   G + Y++  +     
Sbjct: 24  IGDAERGKDLF-SMCSGCHEVGRGAENGIGPHLNGIFGRKAGGVEGEYRYSNGLQRAGAD 82

Query: 57  GITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           G+ W  DTL  YLENPK  + GT+M F G+KK  +RAD++AYL+
Sbjct: 83  GLEWHLDTLDAYLENPKALVSGTRMSFRGMKKPQDRADVLAYLR 126


Go to top
>tr|A5G0B6|A5G0B6_ACICJ Cytochrome c, class I precursor.
          Length = 123

 Score = 92.8 bits (229), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +V  GK +F  +CA CH+V  G ++  GP+L G++G K     GF ++ A K  GI W 
Sbjct: 22  ANVAHGKALFQAQCAACHSVSPG-QNGIGPSLAGVYGAKAAATPGFQFSPALKKSGIVWN 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             TL ++L NP+  +PGTKM + G+    +RAD++AYL+
Sbjct: 81  ASTLDKFLANPQADVPGTKMPYMGMANATDRADVVAYLQ 119


Go to top
>tr|Q7W7X0|Q7W7X0_BORPA Putative cytochrome c.
          Length = 136

 Score = 92.4 bits (228), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  +G++++  +C  CH +      + GP   GL GRK G   GF+YT A ++ G+TW  
Sbjct: 28  DPVRGEQVYA-RCLACHAL---AYDRVGPRHCGLLGRKAGSVPGFAYTQAMEDSGLTWDA 83

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            TL  +L +P K +PGT M +AG+   GERADLIAYL+
Sbjct: 84  TTLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYLR 121


Go to top
>tr|A9FGZ6|A9FGZ6_9RHOB Diheme cytochrome c SoxD.
          Length = 349

 Score = 92.4 bits (228), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 61/105 (58%), Gaps = 4/105 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGITW 60
           V KG+K F +KC  CH +  G K KTGP L+G+ G       GF Y+ A K     G+ W
Sbjct: 246 VAKGEKTF-RKCKSCHQIGAGAKSKTGPILNGIIGAPAAHVEGFRYSKAMKAAAEDGLVW 304

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E  L  +L  PKKY+ GTKM FAG+KK  +   +IAYLK AT E
Sbjct: 305 DEAELAAFLAKPKKYMKGTKMSFAGLKKDADIEAVIAYLKAATAE 349


Go to top
>tr|A4XFG5|A4XFG5_NOVAD Cytochrome c, class I precursor.
          Length = 127

 Score = 92.4 bits (228), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV +GK +F  +CA CH V  G +   GPNL G+ GRK   A  ++Y+ A     ITW  
Sbjct: 28  DVARGKALFA-RCAGCHAVVPGAR-SIGPNLAGVEGRKAASAGSYAYSPALARLKITWDR 85

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             L ++L  P+K  PG+KM FAG+   G+RAD+IAYL
Sbjct: 86  GNLDKFLAGPQKMAPGSKMAFAGLADPGQRADVIAYL 122


Go to top
>tr|A5FTZ2|A5FTZ2_ACICJ Cytochrome c, class I precursor.
          Length = 199

 Score = 92.4 bits (228), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G+  KGK IF  +CA CH+V   G++  GP+L+G+FG+     AGF ++ A K+  I W 
Sbjct: 96  GNAVKGKSIFSAQCAACHSVV-AGQNGIGPSLYGVFGKPAASVAGFPFSPALKSAHIVWT 154

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
              L ++L NP+  +PGTKM + G+    +RA++IAYL
Sbjct: 155 AAALDKFLTNPQAAVPGTKMPYMGMPNAQKRANVIAYL 192


Go to top
>tr|A9HWA3|A9HWA3_9RHOB Cytochrome c2.
          Length = 234

 Score = 92.4 bits (228), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 4/106 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGIT 59
           D +KG+++F Q CA CH V +G ++  GP L+G+FGR  G+  G  Y+       N G+ 
Sbjct: 27  DADKGREVFRQ-CASCHKVGEGAENGIGPQLNGVFGRTAGRVEGVKYSKNMIRMGNDGLI 85

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           W   TL  Y+ENP+  +  T+M F GIK + ER+DL+AYL++ +++
Sbjct: 86  WTAQTLDAYIENPRALVSKTRMSFRGIKNEQERSDLMAYLRRYSDD 131


Go to top
>tr|B0ULC2|B0ULC2_METS4 Cytochrome c class I precursor.
          Length = 118

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F Q C  CH     GK+  GP+L G+ GRK G   G+SY+ A K+ G+TW E
Sbjct: 22  DAAAGEKLFSQ-CKACHAF---GKNGVGPDLKGVVGRKAGTHEGYSYSAALKDSGLTWDE 77

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            TL ++L NPK  + GTKMI+AG+K+  +  DL+AYLK
Sbjct: 78  ATLHKWLANPKGLVSGTKMIYAGLKEDKKIDDLVAYLK 115


Go to top
>tr|Q2GCC9|Q2GCC9_NOVAD Cytochrome c, class I precursor.
          Length = 160

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (66%), Gaps = 1/87 (1%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           C  CH+VEKG KH  GP+L G++G K G  AG+S++ A K  G+TW + TL  +L +P K
Sbjct: 73  CKSCHSVEKG-KHVIGPSLFGIYGTKAGDVAGYSFSPAMKASGLTWDDATLDRFLASPMK 131

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLKK 101
            +PGT+M +AG     +R +LIAY+K 
Sbjct: 132 TVPGTRMTYAGQPDAAKRQELIAYIKS 158


Go to top
>prf|3311456NQM|cytochrome c
          Length = 182

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           HT  KG K+  GPNL G+ G K G+  GF+++ A K KG TW  D L +++ NPK YIPG
Sbjct: 87  HTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQAIKAKGGTWTIDALNQFIANPKGYIPG 146

Query: 79  TKMIFAGIKKKGERADLIAYLKKATN 104
           T M FAGI+K  ERAD++AYL   ++
Sbjct: 147 TAMGFAGIQKDSERADVLAYLNSLSD 172


Go to top
>tr|A5ERZ5|A5ERZ5_BRASB Cytochrome c.
          Length = 182

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           HT  KG K+  GPNL G+ G K G+  GF+++ A K KG TW  D L +++ NPK YIPG
Sbjct: 87  HTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQAIKAKGGTWTIDALNQFIANPKGYIPG 146

Query: 79  TKMIFAGIKKKGERADLIAYLKKATN 104
           T M FAGI+K  ERAD++AYL   ++
Sbjct: 147 TAMGFAGIQKDSERADVLAYLNSLSD 172


Go to top
>tr|Q47FP8|Q47FP8_DECAR Cytochrome c, class I precursor.
          Length = 126

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITW 60
           GD +KG  +F ++C  CH+    GK+K GP+L+G+F RK G  A FS Y+DA K  GITW
Sbjct: 25  GDAKKGADVFAEECGDCHSTV-AGKNKKGPSLNGVFSRKAGSVADFSGYSDAMKQSGITW 83

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             + +  Y+  PKK + G KM + G+     R D+IAYL
Sbjct: 84  NPEKIDAYITQPKKVVAGGKMKYDGLGDAAARGDVIAYL 122


Go to top
>tr|A0NXV5|A0NXV5_9RHOB Diheme cytochrome c SoxD.
          Length = 373

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD EKG+K+F +KC  CH V +G K+K GP L+ +FGR  G    + Y+ A     + G+
Sbjct: 27  GDAEKGEKVF-KKCTACHAVGEGAKNKVGPELNEVFGRTAGSLEDYKYSKAMIDAGSGGL 85

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E TL  YL  PK  + GTKM FAG+KK+ +  ++IAYL
Sbjct: 86  VWDETTLTTYLTKPKDMVKGTKMAFAGLKKQEDLENVIAYL 126


Go to top
>tr|Q1YKE8|Q1YKE8_9RHIZ Putative cytochrome c.
          Length = 167

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 63/101 (62%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI--- 58
           GD + GKK+F +KC  CH V +G K+K GP L+G+ G K G   G+S++ A +       
Sbjct: 46  GDPDAGKKVF-RKCMACHAVGEGAKNKIGPELNGIVGEKPGAVEGYSFSPAFQEWAADKA 104

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E+ +  +L NP+  + GTKM+F GIKK+ E  D+IAYL
Sbjct: 105 AWNEELMTAWLTNPRDVVKGTKMVFPGIKKEQEMVDIIAYL 145


Go to top
>tr|B1LWI4|B1LWI4_METRJ Cytochrome c class I precursor.
          Length = 121

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 60/99 (60%), Gaps = 4/99 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+K F   C  CH  +K G    GP+L G+ GRK G   G++Y+ A KN GITW 
Sbjct: 24  GDAAAGEKAFA-PCKACHNFQKNG---VGPDLKGVVGRKAGTYEGYNYSAALKNSGITWD 79

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L E+L+NPK  +PGTKMIF G     +  D+IAYLK
Sbjct: 80  EANLHEWLKNPKAKVPGTKMIFQGYPDDKKINDVIAYLK 118


Go to top
>prf|3101377AYL|diheme cytochrome c
          Length = 236

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 4/104 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKG 57
           +GD  +G+++F Q CA CH V +G +H TGP+L+G+F RK  Q   F Y+      +  G
Sbjct: 27  IGDAARGEELF-QVCASCHQVGEGAEHGTGPHLNGIFDRKVAQFEDFDYSPGILRARRDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + W  + L  YL NPK  + GT M FAG+    +R D++AYL++
Sbjct: 86  MVWDLEHLDAYLTNPKTLVSGTNMDFAGLPDPQDRGDILAYLRR 129


Go to top
>tr|Q5LUQ3|Q5LUQ3_SILPO Diheme cytochrome c SoxE.
          Length = 236

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 4/104 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKG 57
           +GD  +G+++F Q CA CH V +G +H TGP+L+G+F RK  Q   F Y+      +  G
Sbjct: 27  IGDAARGEELF-QVCASCHQVGEGAEHGTGPHLNGIFDRKVAQFEDFDYSPGILRARRDG 85

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + W  + L  YL NPK  + GT M FAG+    +R D++AYL++
Sbjct: 86  MVWDLEHLDAYLTNPKTLVSGTNMDFAGLPDPQDRGDILAYLRR 129


Go to top
>tr|A4GIG4|A4GIG4_9BACT WD domain/cytochrome C family protein.
          Length = 435

 Score = 91.7 bits (226), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           ++  G++ F +KC+ CHT+ K G  + GP L+ +FGR+ G   G+ Y+ A  +  I WGE
Sbjct: 330 EISNGERQFARKCSVCHTLVKDGAKRAGPTLYNIFGREAGTLPGYKYSKALLDSDIIWGE 389

Query: 63  DTLME-YLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +T+   + + P    PGTKM    +K + +R DLIA+LK+AT
Sbjct: 390 ETIHRLFTDGPDVVTPGTKMPIQRMKNEADRQDLIAFLKQAT 431


Go to top
>tr|A9F4N3|A9F4N3_9RHOB Cytochrome c family protein.
          Length = 121

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (67%), Gaps = 2/93 (2%)

Query: 8   KKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLME 67
           +K+F +KCA CH VE+G K K GP + G++GR  G   G+ Y+ A +    +W E+ L  
Sbjct: 28  EKVF-KKCAACHAVEEG-KKKVGPTMFGIWGRPAGAVEGYKYSSAMQEAEFSWDEEQLTG 85

Query: 68  YLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +L  PKK++PGTKM F G+KK+ + +DL+AYLK
Sbjct: 86  FLAAPKKHLPGTKMAFPGLKKEQQISDLLAYLK 118


Go to top
>tr|B1CUX1|B1CUX1_RHILT Cytochrome c class I precursor.
          Length = 129

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 61/103 (59%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD   G  +F +KCA CH VE    +K GP+L+ LFGRK G    F+Y+ A K  G   +
Sbjct: 26  GDATAGATVF-KKCATCHVVESD-TNKVGPSLNKLFGRKAGTHPDFAYSAAMKAAGEGGL 83

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E  L +YL NPK  + GTKM F G+K   E  DLIAYLK+
Sbjct: 84  VWDEAVLRDYLHNPKAKVKGTKMAFVGVKDDQEITDLIAYLKQ 126


Go to top
>tr|A3JNU1|A3JNU1_9RHOB Cytochrome c552.
          Length = 172

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 66/98 (67%), Gaps = 3/98 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV KG+K+F +KC+ CH + +G ++ TGP L+G+ GR    + GF+Y+ A    G TW 
Sbjct: 73  ADVSKGEKVF-KKCSACHKLGEG-ENGTGPALYGVVGRAASASDGFAYSGAFAEVG-TWT 129

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  +LE PKKY PGTKM F G+KK  +RA++IAY+
Sbjct: 130 PEALQAFLEAPKKYAPGTKMAFNGLKKIQDRANVIAYI 167


Go to top
>tr|B1LVX4|B1LVX4_METRJ Cytochrome c class I precursor.
          Length = 323

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/99 (48%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +VEKG+    + C  CH+ EKGG +K GP+L+G+  R  G  AGF Y+ A K KG TW 
Sbjct: 69  ANVEKGEA-GTKACHACHSFEKGGPNKVGPDLYGIVERPKGAHAGFDYSAAMKEKGGTWT 127

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
              L E+L +PK Y+ GTKM +AGI    ERA++IAYL+
Sbjct: 128 YADLDEFLTSPKAYVKGTKMAYAGIAAPQERANVIAYLR 166


Go to top
>tr|A5FW83|A5FW83_ACICJ Cytochrome c, class I.
          Length = 474

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 63/101 (62%), Gaps = 1/101 (0%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI-TWGEDT 64
           KG+ +F Q+C+ CH++ KGG +  GPNL+G+ G K   AAG+S++ A K      W    
Sbjct: 369 KGQAMFQQQCSACHSINKGGANGVGPNLYGVVGAKMFAAAGYSFSSAAKKHATGDWTAHE 428

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           L E+L +P K +PGT M + GIK    RA++IAYL + ++ 
Sbjct: 429 LNEWLYDPMKAVPGTHMAYPGIKNNVARANMIAYLNQQSDH 469



Go to top
 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA-NKNKGITWG 61
           DV+KG+    Q+CA CHT+ KGG    GPNL+G+ G    + AG++++ A  K     W 
Sbjct: 81  DVKKGEAFVQQQCAACHTLNKGGAAGVGPNLYGVMGEPMFKKAGYTFSGAVTKAASGVWT 140

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              + E+L++P+K+ PGT+M + GIK    RAD IAYL+  ++ 
Sbjct: 141 YQKMNEWLDDPQKFAPGTRMGYTGIKNDNVRADAIAYLRTLSDN 184



Go to top
 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGI-TWG 61
           D  KG+  F Q+C+ CHTV KGG +  GPNL+G+ G      AG++++ A K      W 
Sbjct: 223 DASKGEAFFQQQCSACHTVTKGGANGVGPNLYGVVGAPMFAKAGYTFSGAAKKHADGKWT 282

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              L E+L  P K +PGT M + GIK    RAD+IAYL K ++ 
Sbjct: 283 PHELDEWLYAPTKAVPGTHMAYPGIKNNQTRADVIAYLNKQSDH 326


Go to top
>tr|A3WE73|A3WE73_9SPHN Cytochrome C.
          Length = 224

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
            G+++F  KC+ CH++E GG +  GPNLHG+ G   G  +G+SY+ A  + G  WG + +
Sbjct: 86  DGERVFA-KCSACHSIEAGGANGVGPNLHGIMGAPVGNVSGYSYSSAMASFGGNWGWEEM 144

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             +L+NP+ Y+ GTKM FAG+    +RA +  Y+ +
Sbjct: 145 NNWLDNPRGYMDGTKMGFAGLSSIEDRAAVSLYMNE 180


Go to top
>tr|A8TII4|A8TII4_9PROT Isopropylmalate isomerase small subunit (EC
           4.2.1.33).
          Length = 201

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN--KGIT 59
            DV  G+K   +KCA CHT +K G +K GPNL G+  R      GF+Y+DA K   +   
Sbjct: 73  ADVAAGEK-GAKKCAACHTFDKSGANKVGPNLFGVVNRTKASHDGFNYSDAMKAFAEPKE 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           W   +L  +L  P  YI GTKM FAG+KK  +RADLIAYL+
Sbjct: 132 WTYTSLNNFLHKPTDYIKGTKMNFAGVKKASDRADLIAYLR 172


Go to top
>tr|Q1V1R6|Q1V1R6_9RICK Cytochrome C.
          Length = 189

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +GDV  G+KIF +KCA CH++EKGG +K GP L+ + G K G    + Y+    + G  W
Sbjct: 81  LGDVTSGEKIF-KKCAACHSIEKGGPNKIGPALYNVVGSKVGAVEDYKYSKTLASYGKDW 139

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             + L  +L  P  Y+ GTKM +AG++K+ +RA +I YL + ++
Sbjct: 140 TFEELNGFLTKPSSYLKGTKMSYAGLRKEADRASIIKYLNQNSD 183


Go to top
>tr|A6UC76|A6UC76_SINMW Cytochrome c class I precursor.
          Length = 132

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 65/103 (63%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD E G  +F ++CA CH +++  ++K GP+L G+ GR  G    F Y+ A  + G   +
Sbjct: 29  GDAEAGATVF-KRCATCHVIDED-QNKVGPSLKGIMGRTAGTHPDFKYSQAMVDAGKGGL 86

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E TL +YL NP+  + GTKM+F G+KK  E A++IAYLK+
Sbjct: 87  VWDEATLADYLRNPRAKVKGTKMVFPGLKKDEELANVIAYLKQ 129


Go to top
>tr|B0J2R9|B0J2R9_RHILT Cytochrome c class I precursor.
          Length = 129

 Score = 90.5 bits (223), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 60/103 (58%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD   G  +F +KCA CH V     +K GP+L+GLFGRK G    F+Y+   K  G   +
Sbjct: 26  GDATAGATVF-KKCATCH-VADSDTNKVGPSLNGLFGRKAGTHPNFAYSAGMKAAGEGGL 83

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E  L +YL NPK  + GTKM F G+K   E  DLIAYLK+
Sbjct: 84  VWDETVLRDYLHNPKAKVKGTKMAFVGVKDDQEITDLIAYLKQ 126


Go to top
>tr|A9FKB5|A9FKB5_9RHOB Diheme cytochrome c SoxD.
          Length = 349

 Score = 90.5 bits (223), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 61/105 (58%), Gaps = 4/105 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGITW 60
           V KG+K F +KC  CH + +G K KTGP L+G+ G       GF Y+ A K     G+ W
Sbjct: 246 VAKGEKTF-RKCKSCHQIGEGAKSKTGPILNGIIGAPAAHVEGFRYSKAMKAAAEGGLVW 304

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            E  L  +L  PKKY+ GTKM F G+KK  +   +IAYLK AT E
Sbjct: 305 DEAELAAFLAKPKKYMKGTKMSFVGLKKDADIEAVIAYLKAATAE 349


Go to top
>sp|P00088|CYC22_RHOMO Cytochrome c2 iso-2.
          Length = 97

 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 57/86 (66%), Gaps = 1/86 (1%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           C  CH+VE  GK+  GP+L G++GRK G  +GF ++D +   G+TW E TL +YL +PK 
Sbjct: 10  CKACHSVE-AGKNGVGPSLAGVYGRKAGTISGFKFSDPHIKSGLTWDEPTLTKYLADPKT 68

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLK 100
            IPG KM+FAG+K   +   +I YLK
Sbjct: 69  VIPGNKMVFAGLKNPDDVKAVIEYLK 94


Go to top
>tr|Q210C1|Q210C1_RHOPB Cytochrome c, class I precursor.
          Length = 184

 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 59/87 (67%), Gaps = 1/87 (1%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTLMEYLENPKKYIP 77
           HT EKGG ++TGPNL G+ G   G+   GF+++ A K KG +W  D L ++L +PK YIP
Sbjct: 88  HTFEKGGPNRTGPNLFGVVGDHIGEGRNGFNFSAAMKAKGGSWTFDALNQFLASPKGYIP 147

Query: 78  GTKMIFAGIKKKGERADLIAYLKKATN 104
           GT M FAGI K  ERAD+I+YL+   +
Sbjct: 148 GTAMGFAGIPKDSERADVISYLRSLAD 174


Go to top
>tr|Q5GTG0|Q5GTG0_WOLTR Cytochrome c2.
          Length = 175

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (61%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
             +EKGK I  +KC  CH+ +KGG +K GPNL  + G K       F+Y+ A   KG  W
Sbjct: 66  ASLEKGKSI-AKKCIACHSFDKGGANKVGPNLWNIVGNKKAHLGDSFNYSKAMLEKGGKW 124

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           G + L  +L++PK YI GT+M FAGI    E ADL++YL++ ++
Sbjct: 125 GYEELFAFLKSPKDYIKGTRMAFAGISNPQEIADLVSYLRQLSD 168


Go to top
>prf|3122318YT|cytochrome c
          Length = 179

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +GDV  G+KIF +KCA CH++EKGG +K GP L+ + G K G    + Y+    + G  W
Sbjct: 71  LGDVTLGEKIF-KKCAACHSIEKGGPNKIGPALYNVVGSKVGAVEDYKYSKTLASYGKDW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             + L  +L  P  Y+ GTKM +AG++K+ +RA +I YL + ++
Sbjct: 130 TFEELNGFLTKPSSYLKGTKMSYAGLRKEADRASIIKYLNQNSD 173


Go to top
>tr|Q4FNB3|Q4FNB3_PELUB Cytochrome C.
          Length = 179

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +GDV  G+KIF +KCA CH++EKGG +K GP L+ + G K G    + Y+    + G  W
Sbjct: 71  LGDVTLGEKIF-KKCAACHSIEKGGPNKIGPALYNVVGSKVGAVEDYKYSKTLASYGKDW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             + L  +L  P  Y+ GTKM +AG++K+ +RA +I YL + ++
Sbjct: 130 TFEELNGFLTKPSSYLKGTKMSYAGLRKEADRASIIKYLNQNSD 173


Go to top
>tr|B1WJW7|B1WJW7_OLICA Cytochrome c2.
          Length = 146

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT---DANKNKGI 58
           GDV KG++ F + C  CH V  G K+K GP L+G+ GRK     G++Y+    A KN  +
Sbjct: 38  GDVTKGEQAF-KVCMACHAVGPGAKNKVGPELNGIVGRKWAAVEGYNYSADLTAGKNSKV 96

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E TL +Y+ NPK   P  KM F GI + G+RAD+IAYLK+
Sbjct: 97  -WDEATLDDYITNPKHLAPRGKMAFPGISQAGKRADVIAYLKQ 138


Go to top
>tr|A3W515|A3W515_9RHOB Diheme cytochrome c SoxD.
          Length = 355

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 64/99 (64%), Gaps = 4/99 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGITW 60
           +  G+K+F +KC+ CH V +G  ++ GP L+G+ GR  G A GF Y+DA +     G+ W
Sbjct: 253 IAAGEKVF-KKCSACHQVGEGATNRVGPVLNGVMGRAAGSAEGFKYSDALQAMAGDGLVW 311

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            ++TL E+L NP+ ++ GTKM FAG+KK  +   + AYL
Sbjct: 312 TDETLKEFLANPRGFMKGTKMSFAGLKKDEDLTAISAYL 350


Go to top
>tr|Q2N842|Q2N842_ERYLH Cytochrome C.
          Length = 225

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV  G+ +F  KC  CHT+E+GG +  GPNL+G+ G+     AGF+Y+DA   K   W  
Sbjct: 69  DVSAGEAVFA-KCTACHTIEQGGANGIGPNLYGIMGKDIASLAGFAYSDALSAKEGAWTW 127

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           D +  +L++P+ Y  GTKM FAG+ K  +RA +  Y+  
Sbjct: 128 DEMNAWLKSPRGYANGTKMSFAGLSKIEDRAAVALYMNS 166


Go to top
>tr|A9DG76|A9DG76_9RHIZ Probable sulfite oxidase cytochrome subunit.
          Length = 370

 Score = 89.7 bits (221), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 63/102 (61%), Gaps = 4/102 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GDV  G+K+F +KC  CH V +G KH+ GP+L+ +FGR  G   G+ Y+ A       G+
Sbjct: 26  GDVGAGEKVF-KKCGACHMVGEGAKHRVGPHLNDMFGRTAGTVDGYKYSKAMIEAGEGGL 84

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            W  +TL +++  PK  + GTKM FAG+KK  +  +L AYLK
Sbjct: 85  VWSAETLAQFMIKPKDMVKGTKMSFAGLKKDEDIVNLTAYLK 126


Go to top
>prf|1803359A|cytochrome c
          Length = 184

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 1/86 (1%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTLMEYLENPKKYIP 77
           HT EKGG ++ GPNL+G+ G   G+   GF+++ A K KG TW  D L +++ NPK +IP
Sbjct: 88  HTFEKGGPNRVGPNLYGVVGEARGEGRNGFNFSAAMKGKGGTWTFDDLNKFIANPKGFIP 147

Query: 78  GTKMIFAGIKKKGERADLIAYLKKAT 103
           GT M FAGI K  ERAD+IAYL   +
Sbjct: 148 GTAMGFAGIPKDSERADVIAYLNSLS 173


Go to top
>sp|P30323|CYCM_BRAJA Cytochrome c homolog.
          Length = 184

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 1/86 (1%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTLMEYLENPKKYIP 77
           HT EKGG ++ GPNL+G+ G   G+   GF+++ A K KG TW  D L +++ NPK +IP
Sbjct: 88  HTFEKGGPNRVGPNLYGVVGEARGEGRNGFNFSAAMKGKGGTWTFDDLNKFIANPKGFIP 147

Query: 78  GTKMIFAGIKKKGERADLIAYLKKAT 103
           GT M FAGI K  ERAD+IAYL   +
Sbjct: 148 GTAMGFAGIPKDSERADVIAYLNSLS 173


Go to top
>tr|A9CGJ2|A9CGJ2_AGRT5 Cytochrome c2.
          Length = 131

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%), Gaps = 4/106 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGI 58
           GDV KG+ +F ++C+ CH + +G K++ GP L+G+ GR  G    ++Y+ A K     G+
Sbjct: 23  GDVAKGEAVF-KRCSACHAIGEGAKNRVGPQLNGIIGRAAGGVPDYTYSSAMKKAGEDGL 81

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            W  + L ++L  PKK IPG KM  AGI K  +  +LIAY++   +
Sbjct: 82  VWTPEELRDFLSAPKKKIPGNKMALAGISKPEDLDNLIAYIESTAS 127


Go to top
>tr|A4ETC2|A4ETC2_9RHOB Cytochrome c family protein.
          Length = 311

 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 63/100 (63%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   GKK+F +KC  CH++ K GK+  GP+LHG+ G  + Q  GF Y+ A +   +TW 
Sbjct: 212 GDATLGKKVF-RKCKACHSL-KEGKNGAGPSLHGILGTASAQVPGFKYSKAFQQADLTWS 269

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            + L  ++ +PK  +PG +M F G+KK  E  +LIAYL++
Sbjct: 270 VEQLQAFMLDPKGIVPGNRMAFKGLKKLEEAENLIAYLQE 309


Go to top
>tr|A5VMY9|A5VMY9_BRUO2 Cytochrome c, membrane-bound.
          Length = 192

 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 63  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 121

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 122 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 166


Go to top
>tr|Q8G3B1|Q8G3B1_BRUSU Cytochrome c, membrane-bound.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|B0CI59|B0CI59_BRUSI Cytochrome c.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|A9M6P4|A9M6P4_BRUC2 Cytochrome c.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>prf|3110385AP|cytochrome c
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|Q8YEH5|Q8YEH5_BRUME CYTOCHROME C-552.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|Q57FX5|Q57FX5_BRUAB Cytochrome c, membrane-bound.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|Q2YPQ4|Q2YPQ4_BRUA2 Cytochrome c heme-binding site:Cytochrome c,
           class IA/ IB:Cytochrome c, class I:Cytochrome c, class
           IC.
          Length = 202

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++C  CHT +KGG +K GP+L G+ GR      GFSY+ A K  G     
Sbjct: 73  DPARGEVVF-KRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGNK 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 132 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 176


Go to top
>tr|Q21QW9|Q21QW9_RHOFD Cytochrome c, class I precursor.
          Length = 133

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 58/99 (58%), Gaps = 4/99 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G++++  +CA CH +      + GP   GL GR+ G   GF Y+ A K   I W E TL
Sbjct: 31  RGQQLYA-RCAACHALTF---DRVGPRHCGLLGRRAGSVPGFDYSSAMKKSSIVWNEKTL 86

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            ++L NP   +PG+ M +AG+    +RADLIAYLK A +
Sbjct: 87  DQFLTNPLVMVPGSSMTYAGVPGASDRADLIAYLKSANS 125


Go to top
>tr|A3SQC7|A3SQC7_9RHOB Cytochrome c552.
          Length = 173

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG K+F  KC  CH +E G  + TGP L+G+ GR    A GF Y+ + K    TW  
Sbjct: 74  DASKGAKVF-GKCKACHKLEDG-ANATGPYLYGVVGRAVASADGFGYSGSLKPVADTWTP 131

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + L  +LE+PK + PGT M F+G+KK  +RA+LIAYL+ 
Sbjct: 132 ENLNHFLESPKGFAPGTTMSFSGLKKAEDRANLIAYLES 170


Go to top
>prf|3207409EFD|cytochrome c
          Length = 133

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 61/103 (59%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD   G  +F +KCA CH  E    +K GP+L+ LFGRK G    F+Y+   K  G   +
Sbjct: 30  GDAAAGATVF-KKCATCHVAESD-TNKVGPSLNKLFGRKAGTHPDFAYSAGMKAAGEGGL 87

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E TL +YL NPK  + GTKM FAG+K   E  +LIAYLK+
Sbjct: 88  VWDEATLRDYLHNPKAKVKGTKMAFAGVKDDQEITNLIAYLKQ 130


Go to top
>tr|Q2K6Z6|Q2K6Z6_RHIEC Probable cytochrome-c protein.
          Length = 133

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 61/103 (59%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD   G  +F +KCA CH  E    +K GP+L+ LFGRK G    F+Y+   K  G   +
Sbjct: 30  GDAAAGATVF-KKCATCHVAESD-TNKVGPSLNKLFGRKAGTHPDFAYSAGMKAAGEGGL 87

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E TL +YL NPK  + GTKM FAG+K   E  +LIAYLK+
Sbjct: 88  VWDEATLRDYLHNPKAKVKGTKMAFAGVKDDQEITNLIAYLKQ 130


Go to top
>tr|A7IIN0|A7IIN0_XANP2 Cytochrome c class I.
          Length = 181

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           H  ++G   K GP+L+G+ GR    AAGF+Y+ A K KG  W    L  +L +PK  +PG
Sbjct: 86  HNFQEGAGAKVGPDLYGVVGRPVASAAGFAYSAAMKAKGGDWTALALNTFLTSPKTAVPG 145

Query: 79  TKMIFAGIKKKGERADLIAYLKKATNE 105
           T M FAGI K+ ERADLIAYL   +++
Sbjct: 146 TAMAFAGIPKEAERADLIAYLNSLSHD 172


Go to top
>prf|3206311AJQ|cytochrome c-like protein
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK+I  +KC  CHT EKGG +K GPNL  + G K       F+Y+ A  N G TW
Sbjct: 73  ANITKGKEI-SKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNYSKAMLNIGGTW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L ++L  P+ Y+ GT+M FAGI K  + ADLIAY+K 
Sbjct: 132 EYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKS 172


Go to top
>tr|Q5FG01|Q5FG01_EHRRG Cytochrome c homolog.
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK+I  +KC  CHT EKGG +K GPNL  + G K       F+Y+ A  N G TW
Sbjct: 73  ANITKGKEI-SKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNYSKAMLNIGGTW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L ++L  P+ Y+ GT+M FAGI K  + ADLIAY+K 
Sbjct: 132 EYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKS 172


Go to top
>prf|3206311CJE|cytochrome c-like protein
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK+I  +KC  CHT EKGG +K GPNL  + G K       F+Y+ A  N G TW
Sbjct: 73  ANITKGKEI-SKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNYSKAMLNIGGTW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L ++L  P+ Y+ GT+M FAGI K  + ADLIAY+K 
Sbjct: 132 EYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKS 172


Go to top
>prf|3103440AHH|c-type cytochrome
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK+I  +KC  CHT EKGG +K GPNL  + G K       F+Y+ A  N G TW
Sbjct: 73  ANITKGKEI-SKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNYSKAMLNIGGTW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L ++L  P+ Y+ GT+M FAGI K  + ADLIAY+K 
Sbjct: 132 EYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKS 172


Go to top
>tr|Q5HAK9|Q5HAK9_EHRRW Putative c-type cytochrome (Cytochrome c
           homolog).
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK+I  +KC  CHT EKGG +K GPNL  + G K       F+Y+ A  N G TW
Sbjct: 73  ANITKGKEI-SKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNYSKAMLNIGGTW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L ++L  P+ Y+ GT+M FAGI K  + ADLIAY+K 
Sbjct: 132 EYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKS 172


Go to top
>prf|3302410BXV|cytochrome c2
          Length = 125

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD   G+K+F +KC  CH V +  K+K GP L+G+ G   G    F Y+DA       G+
Sbjct: 22  GDPASGEKVF-RKCKACHAVGEDAKNKVGPTLNGIMGAAAGANPDFKYSDALMTMAADGL 80

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E+ +  +L+ PK+Y+P TKM FAG++K  + AD+IAYL
Sbjct: 81  VWTEEEMAAFLKKPKEYMPKTKMSFAGLRKDDDIADVIAYL 121


Go to top
>tr|Q16A02|Q16A02_ROSDO Cytochrome c2.
          Length = 125

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD   G+K+F +KC  CH V +  K+K GP L+G+ G   G    F Y+DA       G+
Sbjct: 22  GDPASGEKVF-RKCKACHAVGEDAKNKVGPTLNGIMGAAAGANPDFKYSDALMTMAADGL 80

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E+ +  +L+ PK+Y+P TKM FAG++K  + AD+IAYL
Sbjct: 81  VWTEEEMAAFLKKPKEYMPKTKMSFAGLRKDDDIADVIAYL 121


Go to top
>tr|Q2GHD6|Q2GHD6_EHRCR Cytochrome C, membrane-bound.
          Length = 172

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK +  +KC  CHT EKGG ++ GPNL  + G K       F+Y+ A  +KG TW
Sbjct: 71  ANIAKGKDL-TKKCISCHTFEKGGANRVGPNLWHIVGNKKAHLGDSFNYSKAMLSKGGTW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               L ++L  P+ YI GT+M FAGI K  + ADLIAYLK
Sbjct: 130 EYQDLFQFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLK 169


Go to top
>tr|Q40IT9|Q40IT9_EHRCH Cytochrome c, class I.
          Length = 172

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
            ++ KGK +  +KC  CHT EKGG ++ GPNL  + G K       F+Y+ A  +KG TW
Sbjct: 71  ANIAKGKDL-TKKCISCHTFEKGGANRVGPNLWHIVGNKKAHLGDSFNYSKAMLSKGGTW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               L ++L  P+ YI GT+M FAGI K  + ADLIAYLK
Sbjct: 130 EYQDLFQFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLK 169


Go to top
>tr|Q1YN57|Q1YN57_9RHIZ Diheme cytochrome c SoxD.
          Length = 385

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGI 58
           GD   GKK+F  +C  CH V +G ++K GP+L+ L+GR  G    ++Y+   K    +G+
Sbjct: 28  GDAAAGKKVF-NRCRACHDVGEGARNKIGPHLNDLYGRSAGGLDDYNYSPVVKTAGAEGL 86

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W ++TL  YL +P+  +PG +M F G+KK  E  DL+AYL
Sbjct: 87  VWNDETLAAYLADPRGMLPGNRMAFPGLKKDSEVTDLLAYL 127


Go to top
>tr|B1ZJ24|B1ZJ24_METPB Cytochrome c class I precursor.
          Length = 307

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D +KGK    + C  CH+ EKGG +K GP+L  +  R+     GF Y+   K KG +W 
Sbjct: 70  ADADKGKG-GTKACQACHSFEKGGPNKVGPDLWDIVERQKAHHEGFDYSAGLKEKGGSWT 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            + L  +LENPK Y+ GTKM FAGI    ERA++IAYL+
Sbjct: 129 YEDLDHFLENPKGYVKGTKMAFAGISSPTERANVIAYLR 167


Go to top
>prf|3216294DTC|cytochrome c
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 64/98 (65%), Gaps = 6/98 (6%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGED 63
           G+K+F  KCA CH V+  G   TGP+L+G+  R     AGF+Y+DA   +  +  TW  +
Sbjct: 78  GQKVF-AKCAACHKVD--GSDATGPHLNGVVDRAVASVAGFAYSDAMVAHAAEAPTWTLE 134

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  ++ENPK ++PGTKM FAG+ K+ +RA+++AYL  
Sbjct: 135 ELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLAS 172


Go to top
>tr|Q3J003|Q3J003_RHOS4 Cytochrome cy.
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 64/98 (65%), Gaps = 6/98 (6%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGED 63
           G+K+F  KCA CH V+  G   TGP+L+G+  R     AGF+Y+DA   +  +  TW  +
Sbjct: 78  GQKVF-AKCAACHKVD--GSDATGPHLNGVVDRAVASVAGFAYSDAMVAHAAEAPTWTLE 134

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  ++ENPK ++PGTKM FAG+ K+ +RA+++AYL  
Sbjct: 135 ELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLAS 172


Go to top
>tr|A3PM96|A3PM96_RHOS1 Cytochrome c, class I precursor.
          Length = 174

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 64/98 (65%), Gaps = 6/98 (6%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGED 63
           G+K+F  KCA CH V+  G   TGP+L+G+  R     AGF+Y+DA   +  +  TW  +
Sbjct: 78  GQKVF-AKCAACHKVD--GSDATGPHLNGVVDRAVASVAGFAYSDAMVAHAAEAPTWTLE 134

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  ++ENPK ++PGTKM FAG+ K+ +RA+++AYL  
Sbjct: 135 ELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLAS 172


Go to top
>tr|Q884L8|Q884L8_PSESM Cytochrome c2.
          Length = 122

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 56/98 (57%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F + C+ CH +    +   GP L+G+ GRK GQ  G+ YTDA KN G+ W 
Sbjct: 21  GDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRKAGQQEGYVYTDAMKNSGLIWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  Y+++P + +PGT+M    +       DL+ YL
Sbjct: 81  REELRMYIKDPSEVVPGTRMKLWWMGNDERMEDLLEYL 118


Go to top
>tr|A4YLZ0|A4YLZ0_BRASO Cytochrome c homolog.
          Length = 182

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           HT  KG K+  GPNL G+ G K G+  GF+++ A K KG TW  + L +++ NPK YIPG
Sbjct: 87  HTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQAIKAKGGTWTIEELNKFITNPKGYIPG 146

Query: 79  TKMIFAGIKKKGERADLIAYLKKATN 104
           T M FAGI+K  ERAD++AYL   ++
Sbjct: 147 TAMGFAGIQKDSERADVLAYLNSLSD 172


Go to top
>tr|B0KNJ6|B0KNJ6_PSEPG Cytochrome c class I precursor.
          Length = 132

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 57/95 (60%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           ++G+++F + CA CH+ +KGG    GPNLH + GR  G   G +Y+ A K++  +W    
Sbjct: 34  QQGEQVFARDCAACHSAQKGGPAMMGPNLHDVVGRTPGSVPGANYSQAMKSRQASWTAQA 93

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           +  ++E P+  +PGT M +AG+   GER  +  +L
Sbjct: 94  IGAFIEQPQAAVPGTYMPYAGLPDAGERQAVTCFL 128


Go to top
>tr|A1FUA4|A1FUA4_XANMA Cytochrome c, class I precursor.
          Length = 133

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 5/105 (4%)

Query: 5   EKGKKIFVQK----CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           E+ ++  +Q+    CA CHTV+ GG H+ GPNLHG+ GR+ G    + Y+D  +   ITW
Sbjct: 30  EQARQQAMQRAFELCAGCHTVQPGGIHRFGPNLHGVIGRRAGSLPDYGYSDGMRRADITW 89

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              TL  +L++P   +PGT+M +        RA +IAYL++ + +
Sbjct: 90  SAQTLDAFLQSPTHVVPGTRM-YNAFPSAERRALVIAYLQQQSPQ 133


Go to top
>tr|A9HHD0|A9HHD0_9RHOB Cytochrome c2.
          Length = 125

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD   G+K+F +KC  CH V +  K+K GP L+G+ G   G    F Y+DA       G+
Sbjct: 22  GDPASGEKVF-RKCKACHAVGEDAKNKVGPTLNGIIGAAAGANPDFKYSDALMTMAGDGL 80

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E+ +  +L+ PK+Y+P TKM FAG++K  + AD+IAYL
Sbjct: 81  VWTEEEMAAFLKKPKEYMPKTKMSFAGLRKDDDIADVIAYL 121


Go to top
>tr|A1UU31|A1UU31_BARBK Cytochrome c family protein.
          Length = 185

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (60%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA-NKNKGITW 60
           G++E G+K+F Q CA CH  E+ G ++ GP L G+  R      GF+Y+ A  +N    W
Sbjct: 69  GNIENGRKLFRQ-CAICHASERDGANRIGPPLWGVVDRPFAVMKGFTYSKALRENSDKKW 127

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
              TL  YL++P+K IPGT M F G+K   +RADL+ YL+  ++
Sbjct: 128 DFVTLDRYLQSPRKEIPGTTMSFRGVKNDQDRADLLLYLRSLSD 171


Go to top
>prf|3103441EV|cytochrome c
          Length = 179

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (63%), Gaps = 1/97 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           ++GK +  +KC  CHT +KGG ++ GPNL G+ G K     GF+Y+ A  +    W E+ 
Sbjct: 77  DRGKSV-SKKCVACHTFDKGGPNRVGPNLWGIIGAKKCNTPGFTYSKALSSMQGDWSEEE 135

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           L ++L++P+ Y  GT+M F G+ K  + ADL+AY+K+
Sbjct: 136 LFKFLKSPQSYASGTRMSFVGLSKPQDIADLLAYMKQ 172


Go to top
>tr|Q5PBL1|Q5PBL1_ANAMM Cytochrome C.
          Length = 179

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (63%), Gaps = 1/97 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           ++GK +  +KC  CHT +KGG ++ GPNL G+ G K     GF+Y+ A  +    W E+ 
Sbjct: 77  DRGKSV-SKKCVACHTFDKGGPNRVGPNLWGIIGAKKCNTPGFTYSKALSSMQGDWSEEE 135

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           L ++L++P+ Y  GT+M F G+ K  + ADL+AY+K+
Sbjct: 136 LFKFLKSPQSYASGTRMSFVGLSKPQDIADLLAYMKQ 172


Go to top
>tr|A3X8I7|A3X8I7_9RHOB Diheme cytochrome c SoxD.
          Length = 353

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITW 60
           V KG K+F +KC  CH V +G K+ TGP L+G+FG   G   GF Y+    A    G+ W
Sbjct: 251 VAKGAKVF-KKCKACHKVGEGAKNGTGPILNGIFGATAGVVEGFRYSKPMLAAGEDGLVW 309

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            ++TL  +L  P+K++ GTKM FAG++K+ +   ++AYL+   N
Sbjct: 310 NDETLAAFLAKPRKFMKGTKMSFAGLRKERDIEAVVAYLRSFDN 353


Go to top
>tr|A9DW48|A9DW48_9RHOB Cytochrome c, class I.
          Length = 166

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (59%), Gaps = 3/102 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D + G K+F +KCA CH V+  G +  GP+L G+ GR       F Y+ A  +   +W  
Sbjct: 68  DADSGSKVF-RKCAACHKVD--GSNAVGPHLDGVVGRDIAAVGDFGYSGALSSVDGSWTP 124

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + L  +L +PK Y PGT M FAG++K  +RAD+IAYL+  +N
Sbjct: 125 EELSAFLTSPKGYAPGTTMGFAGLRKVEDRADVIAYLQSVSN 166


Go to top
>tr|B2FHG3|B2FHG3_XANMA Putative cytochrome c precursor.
          Length = 133

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           CA CHTV+ GG H+ GPNLHG+ GR+ G    + Y+D  +   ITW   TL  +L++P  
Sbjct: 44  CAGCHTVQPGGIHRFGPNLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPTH 103

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            +PGT+M +        RA +IAYL++ + +
Sbjct: 104 VVPGTRM-YNAFPSAERRALVIAYLQQQSAQ 133


Go to top
>tr|A8LJ38|A8LJ38_DINSH Cytochrome c class I precursor.
          Length = 235

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 4/106 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KG 57
           +GD E+G ++F Q CA CH +  G + + GP+L+ ++GR+ G    FSY+D        G
Sbjct: 26  IGDPERGAQLFRQ-CASCHQIGDGAESRVGPHLNEIYGRRAGSIERFSYSDGMLRMGADG 84

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + W   TL  Y+ NP+  + GT+M + G+ +  +RADL+AY++  T
Sbjct: 85  LIWDLRTLDAYIANPRALVSGTRMSYRGMPEAQDRADLLAYMRDFT 130


Go to top
>tr|A4WTX3|A4WTX3_RHOS5 Cytochrome c, class I precursor.
          Length = 143

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 60/101 (59%), Gaps = 4/101 (3%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK---GITWGED 63
           G+K F +KC  CH + +G   KTGP L G+ GR      GF+Y+ A       G+ W   
Sbjct: 28  GEKAF-RKCLACHQIGEGATSKTGPVLTGVVGRPAATVEGFAYSKAMAEAAEGGLVWDHA 86

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            L ++L NP+K +PGTKM F GI+K  E AD+IAYL+  ++
Sbjct: 87  ALEDFLANPRKAMPGTKMAFPGIRKPQELADIIAYLETFSD 127


Go to top
>tr|Q73GX6|Q73GX6_WOLPM Cytochrome c family protein.
          Length = 158

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
              EKGK    +KC  CH+ EKGG +K GPNL  + G K       F+Y+ A   +G  W
Sbjct: 49  ASFEKGKSA-AKKCIACHSFEKGGMNKVGPNLWNIVGNKKAHLGNSFNYSKAVLERGGKW 107

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           G + L  +L+NPK YI GT+M FAGI    E ADL++YL + ++
Sbjct: 108 GYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLHQLSD 151


Go to top
>tr|Q4E942|Q4E942_9RICK Cytochrome c family protein.
          Length = 158

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
              EKGK    +KC  CH+ EKGG +K GPNL  + G K       F+Y+ A   +G  W
Sbjct: 49  ASFEKGKSA-AKKCIACHSFEKGGMNKVGPNLWNIVGNKKAHLGNSFNYSKAVLERGGKW 107

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           G + L  +L+NPK YI GT+M FAGI    E ADL++YL + ++
Sbjct: 108 GYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLHQLSD 151


Go to top
>tr|Q4E810|Q4E810_9RICK Cytochrome c family protein.
          Length = 158

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
              EKGK    +KC  CH+ EKGG +K GPNL  + G K       F+Y+ A   +G  W
Sbjct: 49  ASFEKGKSA-AKKCIACHSFEKGGMNKVGPNLWNIVGNKKAHLGNSFNYSKAVLERGGKW 107

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           G + L  +L+NPK YI GT+M FAGI    E ADL++YL + ++
Sbjct: 108 GYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLHQLSD 151


Go to top
>tr|Q133I0|Q133I0_RHOPS Cytochrome c, class I precursor.
          Length = 183

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 59/86 (68%)

Query: 19  HTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPG 78
           HT EK G ++ GPNL+G+ G K G+  GF+++ A K KG  W  + L +++ +PK YIPG
Sbjct: 88  HTFEKDGPNRVGPNLYGIVGEKRGEGRGFNFSAAMKAKGGEWTFEELDKFIASPKGYIPG 147

Query: 79  TKMIFAGIKKKGERADLIAYLKKATN 104
           T M FAGI  + ERADLI+YL K ++
Sbjct: 148 TAMGFAGIGNERERADLISYLNKNSD 173


Go to top
>prf|3117431CUE|cytochrome c
          Length = 122

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F + C+ CH +    +   GP L+G+ GR+ GQ  G+ YTDA KN G+ W 
Sbjct: 21  GDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRQAGQQEGYVYTDAMKNSGLVWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  Y+++P   +PGT+M    +       DL+ YL
Sbjct: 81  REELRTYIKDPSAVVPGTRMKLWWMGNDERMEDLLEYL 118


Go to top
>tr|Q4ZV95|Q4ZV95_PSEU2 Cytochrome c, class I precursor.
          Length = 122

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F + C+ CH +    +   GP L+G+ GR+ GQ  G+ YTDA KN G+ W 
Sbjct: 21  GDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRQAGQQEGYVYTDAMKNSGLVWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  Y+++P   +PGT+M    +       DL+ YL
Sbjct: 81  REELRTYIKDPSAVVPGTRMKLWWMGNDERMEDLLEYL 118


Go to top
>tr|B1Z8Y0|B1Z8Y0_METPB Cytochrome c class I precursor.
          Length = 120

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 5/95 (5%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTL 65
           G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  GITW E  L
Sbjct: 27  GEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGITWDEANL 82

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E+L +PKK +PGTKM+F GIK   +  D+IAYLK
Sbjct: 83  KEWLTDPKKKVPGTKMVFPGIKDPKKVDDIIAYLK 117


Go to top
>tr|A7CLC2|A7CLC2_BURPI Cytochrome c, class I.
          Length = 249

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (56%), Gaps = 3/104 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITW 60
           GD  +G +   + C  CH+     +H TGP+L G+ GRK G A GF+ Y+DA K  G+ W
Sbjct: 52  GDPARGAQA-ARTCMACHSFAPS-RHLTGPSLAGVLGRKAGTADGFARYSDALKQSGLVW 109

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            +  L  +LENP   +PG  M F GI     RADL+AY++  + 
Sbjct: 110 DKRNLDAWLENPAALVPGNAMTFPGIADARTRADLVAYIEAVST 153


Go to top
>prf|3101377AYK|diheme cytochrome c
          Length = 347

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT---DANKNKGITW 60
           V +G+K F +KC  CH V +G K+KTGP L+G+ G   G   GF Y+    A    G+ W
Sbjct: 246 VAEGEKTF-KKCKACHQVGEGAKNKTGPTLNGIVGHAAGAVDGFKYSKPMQAAGEGGLVW 304

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E  L  +L  PK Y+ GTKM FAG+KK  + A +IAYLK
Sbjct: 305 TEAELAAFLAKPKAYMKGTKMSFAGLKKDEDIAAVIAYLK 344


Go to top
>tr|Q5LUQ4|Q5LUQ4_SILPO Diheme cytochrome c SoxD.
          Length = 347

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT---DANKNKGITW 60
           V +G+K F +KC  CH V +G K+KTGP L+G+ G   G   GF Y+    A    G+ W
Sbjct: 246 VAEGEKTF-KKCKACHQVGEGAKNKTGPTLNGIVGHAAGAVDGFKYSKPMQAAGEGGLVW 304

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E  L  +L  PK Y+ GTKM FAG+KK  + A +IAYLK
Sbjct: 305 TEAELAAFLAKPKAYMKGTKMSFAGLKKDEDIAAVIAYLK 344


Go to top
>tr|A5VBD5|A5VBD5_SPHWW Cytochrome c, class I precursor.
          Length = 124

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 56/94 (59%), Gaps = 2/94 (2%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           KG  +F ++C  CHTV+ G K   GPNL G+ GRK G A  F Y+ A K   I+W  D L
Sbjct: 29  KGATLF-KRCVACHTVDPGKKAGMGPNLAGVVGRKAG-ATSFPYSPAMKAAAISWTPDKL 86

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             +L  P   I G++M FAG+    +RAD+IAYL
Sbjct: 87  DTFLTRPAAMIKGSRMAFAGLPNAQDRADVIAYL 120


Go to top
>tr|Q2CI91|Q2CI91_9RHOB Diheme cytochrome c SoxD.
          Length = 163

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 63/101 (62%), Gaps = 5/101 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTG-QAAGFSYTDA---NKNKGIT 59
           V +G+ +F ++C  CH V +  + + GP L+G+FG+        F Y+DA      +G+ 
Sbjct: 29  VAEGEDVF-RRCRSCHMVGEDAQSRVGPMLNGIFGQPAAVHQDDFRYSDAMIEAGEEGLV 87

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           W  +TL  YLE+P+ Y+PGT+M FAG++ + ER  ++AYL+
Sbjct: 88  WTHETLAAYLESPRDYVPGTRMAFAGLRTEEERVAVVAYLQ 128


Go to top
>sp|P00081|CYC2_AGRTC Cytochrome c2.
          Length = 111

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGI 58
           GDV KG+  F ++C+ CH + +G K+K GP L+G+ GR  G    ++Y++A K    +G+
Sbjct: 2   GDVAKGEAAF-KRCSACHAIGEGAKNKVGPQLNGIIGRTAGGDPDYNYSNAMKKAGGEGL 60

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W    L ++L  PKK IPG KM  AGI K  E  +LIAYL
Sbjct: 61  VWTPQELRDFLSAPKKKIPGNKMALAGISKPEELDNLIAYL 101


Go to top
>tr|A4U4B4|A4U4B4_9PROT Cytochrome c.
          Length = 120

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQA-AGFSYTDANKNKGITWGEDTLMEYLENPK 73
           C  CH VE  GKH  GP+L G+FG K G     F Y+DA+K  G+TW E TL +YL +PK
Sbjct: 31  CKACHKVE-AGKHGVGPSLAGVFGTKAGSNYPEFKYSDAHKGSGLTWDEATLSKYLADPK 89

Query: 74  KYIPGTKMIFAGIKKKGERADLIAYLK 100
             IPG KM+FAGIK   +   ++AY+K
Sbjct: 90  GTIPGNKMVFAGIKNPDDLKAVVAYVK 116


Go to top
>tr|Q11AX3|Q11AX3_MESSB Cytochrome c, class I.
          Length = 286

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 5/108 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA----NKNKG 57
            D   G+ +F ++C  CHTVE+GG +K GPNL  +  R      GFSY+ A    ++   
Sbjct: 84  ADASAGEAVF-KRCGACHTVEQGGPNKVGPNLWSVVDRPIASHEGFSYSSALTEFSEGGQ 142

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
             W  + L  +L +PK  +PGT M FAG+ K  +RA+LIAYL+  +++
Sbjct: 143 KLWTYENLDHFLASPKGLVPGTAMSFAGLSKVEDRANLIAYLRTMSDQ 190


Go to top
>tr|A1WIA2|A1WIA2_VEREI Sulfite dehydrogenase (Cytochrome) subunit
           SorB precursor (EC 1.8.2.1).
          Length = 125

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV  G+++F Q CA CH V     +  GP L G+ G K+    GF Y  A K   + W E
Sbjct: 26  DVNAGRQVFAQ-CAACHAVTTA--NGVGPGLWGIVGSKSASVPGFRYGAAIKRAHLIWDE 82

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             L  Y+ +P+K +PGT M F+GI    +RADLIAYLK
Sbjct: 83  KNLDAYIADPQKALPGTLMPFSGIADAQQRADLIAYLK 120


Go to top
>tr|A6UMP0|A6UMP0_SINMW Cytochrome c class I precursor.
          Length = 130

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+++F  +C  CH +  G +++ GP+L G+FGR  G  AG  Y++A +  G  W E+ L 
Sbjct: 31  GERLFRSRCGSCHGLNTG-ENRVGPHLFGVFGRAAGSVAGARYSNALRTSGFVWDEERLH 89

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            YL NP++ +PGT M  A ++ + +R+ +I YL+  + E
Sbjct: 90  AYLNNPRQVVPGTTMS-ASVRDQAQRSAIITYLQSLSAE 127


Go to top
>prf|3121275BNE|cytochrome c2
          Length = 121

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
            +C  CH VE  GKH  GP+L G++G K G A G+ Y+D +   G+ W +  L +YL +P
Sbjct: 32  NQCKACHKVE-AGKHGVGPSLFGVYGAKAGHAEGYKYSDNHVKSGMVWDDANLGKYLADP 90

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLK 100
           K  IPG KM FAG+KK  + A ++AYLK
Sbjct: 91  KATIPGNKMAFAGLKKPEDVAAVVAYLK 118


Go to top
>tr|Q2W7W2|Q2W7W2_MAGMM Cytochrome C2.
          Length = 121

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
            +C  CH VE  GKH  GP+L G++G K G A G+ Y+D +   G+ W +  L +YL +P
Sbjct: 32  NQCKACHKVE-AGKHGVGPSLFGVYGAKAGHAEGYKYSDNHVKSGMVWDDANLGKYLADP 90

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLK 100
           K  IPG KM FAG+KK  + A ++AYLK
Sbjct: 91  KATIPGNKMAFAGLKKPEDVAAVVAYLK 118


Go to top
>tr|A6DWZ4|A6DWZ4_9RHOB WD domain/cytochrome c family protein.
          Length = 436

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           ++E G++ F++KC+ CH +      K GP L+GLFGR+ G   G++Y+D     GI W +
Sbjct: 330 EMENGERQFMRKCSICHALTPPPSRKAGPTLYGLFGRQAGTVPGYAYSDILDGAGIVWND 389

Query: 63  DTLMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            T+    +  P  YIPG+KM    I    +R D+I YL++AT
Sbjct: 390 TTIDALFDLGPDHYIPGSKMPMQRITAAEDRQDMIDYLRRAT 431


Go to top
>tr|A3VZV8|A3VZV8_9RHOB WD domain/cytochrome c family protein.
          Length = 436

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 61/102 (59%), Gaps = 1/102 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           ++E G++ F++KC+ CH +      K GP L+G+FGR+ G   G++Y++     GI W +
Sbjct: 330 EMENGERQFMRKCSICHALTPPPSRKAGPTLYGVFGRRAGTVPGYAYSEILDGSGIVWTD 389

Query: 63  DTLMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           DT+    +  P  YIPG+KM    I    +R D+I YL++AT
Sbjct: 390 DTIDALFDLGPDHYIPGSKMPMQRITAAEDRQDMIDYLRRAT 431


Go to top
>tr|A3JNF3|A3JNF3_9RHOB Cytochrome c family protein.
          Length = 145

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +   E+GK +F ++C  CH + +  K  TGP+L G+  R +G   G+ Y++A     + W
Sbjct: 36  LSSAERGKFVF-RRCQACHAIGEN-KKLTGPSLAGVINRPSGSIEGYRYSNAMAALSVIW 93

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            E TL E+L  P+ ++PGTKM F GIKK  E  DL+AYL
Sbjct: 94  DEKTLTEFLTKPRAFVPGTKMGFGGIKKPQEIQDLLAYL 132


Go to top
>tr|A9W173|A9W173_METEX Cytochrome c class I precursor.
          Length = 120

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 5/95 (5%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTL 65
           G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW E  L
Sbjct: 27  GEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDEANL 82

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E+L +PKK +PGTKM+F GIK   +  D+IAYLK
Sbjct: 83  KEWLADPKKKVPGTKMVFPGIKDPKKVDDIIAYLK 117


Go to top
>tr|A7W7V1|A7W7V1_METCH Cytochrome c, class I precursor.
          Length = 120

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 5/95 (5%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITWGEDTL 65
           G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW E  L
Sbjct: 27  GEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDEANL 82

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E+L +PKK +PGTKM+F GIK   +  D+IAYLK
Sbjct: 83  KEWLTDPKKKVPGTKMVFPGIKDPKKVDDIIAYLK 117


Go to top
>pdb|1QN2_C|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH;
           CHAIN: A, B, C    
          Length = 100

 Score = 86.7 bits (213), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
           GD   G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW
Sbjct: 2   GDAAAGEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +  L ++L +PKK +PGTKM+F GI    +  D+IAYLK
Sbjct: 58  DQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLK 97


Go to top
>pdb|1QN2_B|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH;
           CHAIN: A, B, C    
          Length = 100

 Score = 86.7 bits (213), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
           GD   G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW
Sbjct: 2   GDAAAGEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +  L ++L +PKK +PGTKM+F GI    +  D+IAYLK
Sbjct: 58  DQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLK 97


Go to top
>pdb|1QN2_A|2.01| 3| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME CH;
           CHAIN: A, B, C    
          Length = 100

 Score = 86.7 bits (213), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
           GD   G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW
Sbjct: 2   GDAAAGEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +  L ++L +PKK +PGTKM+F GI    +  D+IAYLK
Sbjct: 58  DQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLK 97


Go to top
>tr|Q7SIA4|Q7SIA4_METEX Cytochrome.
          Length = 100

 Score = 86.7 bits (213), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 5/100 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA-GFSYTDANKNKGITW 60
           GD   G+K F   C  CH  EK G    GP L G+ G K G+ A G++++DA K  G+TW
Sbjct: 2   GDAAAGEKAFAP-CKACHNFEKNG---VGPTLKGVVGAKAGEGADGYAFSDALKKSGLTW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +  L ++L +PKK +PGTKM+F GI    +  D+IAYLK
Sbjct: 58  DQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLK 97


Go to top
>tr|Q1GWW7|Q1GWW7_SPHAL Cytochrome c, class I.
          Length = 329

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           V  GK  F + C  CH++  GG    GP L G+ GRK G    F Y+D  +N GITW  D
Sbjct: 227 VASGKMAFDKTCRACHSINPGGA-GIGPTLAGVVGRKAGTVPNFDYSDQIRNSGITWTAD 285

Query: 64  TLMEYLENPKKYIPGTKM--IFA-GIKKKGERADLIAYLK 100
            + +++E PK +IPG +M  +F  GIK  G+R D+I YLK
Sbjct: 286 NIDKHIEAPKSFIPGNRMGNLFPNGIKDPGQRRDIIVYLK 325


Go to top
>prf|3216294BHY|iso-cytochrome c2
          Length = 144

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSY----TDANKNKG 57
           GD   G+K F +KC  CH +    ++KTGP L G+ GR      GFSY    T+A  + G
Sbjct: 23  GDPAAGEKAF-RKCQACHQIGAEAQNKTGPVLTGVIGRPAASIEGFSYSKTLTEAAAD-G 80

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + W    L  +L NP+K +PGTKM F GIKK  E AD++AYL
Sbjct: 81  LVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL 122


Go to top
>prf|1907189A|iso-cytochrome c2
          Length = 144

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSY----TDANKNKG 57
           GD   G+K F +KC  CH +    ++KTGP L G+ GR      GFSY    T+A  + G
Sbjct: 23  GDPAAGEKAF-RKCQACHQIGAEAQNKTGPVLTGVIGRPAASIEGFSYSKTLTEAAAD-G 80

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + W    L  +L NP+K +PGTKM F GIKK  E AD++AYL
Sbjct: 81  LVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL 122


Go to top
>tr|Q3J3A0|Q3J3A0_RHOS4 Isocytochrome c2.
          Length = 144

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSY----TDANKNKG 57
           GD   G+K F +KC  CH +    ++KTGP L G+ GR      GFSY    T+A  + G
Sbjct: 23  GDPAAGEKAF-RKCQACHQIGAEAQNKTGPVLTGVIGRPAASIEGFSYSKTLTEAAAD-G 80

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + W    L  +L NP+K +PGTKM F GIKK  E AD++AYL
Sbjct: 81  LVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL 122


Go to top
>tr|Q53144|Q53144_RHOSH Isocytochrome c2 precursor (Cytochrome c).
          Length = 144

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSY----TDANKNKG 57
           GD   G+K F +KC  CH +    ++KTGP L G+ GR      GFSY    T+A  + G
Sbjct: 23  GDPAAGEKAF-RKCQACHQIGAEAQNKTGPVLTGVIGRPAASIEGFSYSKTLTEAAAD-G 80

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + W    L  +L NP+K +PGTKM F GIKK  E AD++AYL
Sbjct: 81  LVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL 122


Go to top
>tr|A3PJ29|A3PJ29_RHOS1 Cytochrome c, class I precursor.
          Length = 144

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSY----TDANKNKG 57
           GD   G+K F +KC  CH +    ++KTGP L G+ GR      GFSY    T+A  + G
Sbjct: 23  GDPAAGEKAF-RKCQACHQIGAEAQNKTGPVLTGVIGRPAASIEGFSYSKTLTEAAAD-G 80

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + W    L  +L NP+K +PGTKM F GIKK  E AD++AYL
Sbjct: 81  LVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL 122


Go to top
>tr|A0NUZ1|A0NUZ1_9RHOB Cytochrome c family protein.
          Length = 131

 Score = 86.3 bits (212), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGI 58
           GD  KG+K+F +KCA CH V    K+K GP L+G+ GR  G   G+ Y+ AN      G 
Sbjct: 23  GDPAKGEKVF-KKCAACHAVGPDAKNKVGPELNGIVGRPWGAVDGYKYS-ANLLELADGK 80

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W ++TL  YL  PK  IP  KM FAG+KK+ +R ++IAYL +
Sbjct: 81  VWDDETLDAYLTKPKDLIPKGKMAFAGLKKEDDRENVIAYLNQ 123


Go to top
>prf|3218314AVC|cytochrome c family protein
          Length = 185

 Score = 86.3 bits (212), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (59%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           C  CH   +G  +  GPNLHG+F R+     GF+Y+ A   +   W  + L  +LENP+ 
Sbjct: 82  CQSCHLTAEGAGNLVGPNLHGIFSRQVATVEGFAYSPALSAETFMWTPEQLDHWLENPRT 141

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++PG +M F+G++++ +R  +IAYL   T
Sbjct: 142 FVPGNRMSFSGVRREADRLGVIAYLMVET 170


Go to top
>tr|Q0C3Q4|Q0C3Q4_HYPNA Cytochrome c family protein.
          Length = 185

 Score = 86.3 bits (212), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (59%)

Query: 15  CAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKK 74
           C  CH   +G  +  GPNLHG+F R+     GF+Y+ A   +   W  + L  +LENP+ 
Sbjct: 82  CQSCHLTAEGAGNLVGPNLHGIFSRQVATVEGFAYSPALSAETFMWTPEQLDHWLENPRT 141

Query: 75  YIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++PG +M F+G++++ +R  +IAYL   T
Sbjct: 142 FVPGNRMSFSGVRREADRLGVIAYLMVET 170


Go to top
>tr|A0NZM4|A0NZM4_9RHOB Cytochrome c family protein.
          Length = 127

 Score = 86.3 bits (212), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 8   KKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK---GITWGEDT 64
           +KIF +KC  CH V  G K+K GP L+G+ G   GQ  G+ Y+ +   K   G+ W E+T
Sbjct: 30  EKIF-KKCQACHAVGDGAKNKVGPALNGIVGAPAGQVEGYKYSASMTEKAEGGLVWDEET 88

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           L  YL  PK  +P TKM FAG++K  E  ++IAYLK
Sbjct: 89  LTAYLHKPKDVVPKTKMSFAGLRKDEEIENVIAYLK 124


Go to top
>tr|Q4PJF4|Q4PJF4_9BACT Predicted WD domain/cytochrome C family
           protein.
          Length = 439

 Score = 85.9 bits (211), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           +  G+K F +KC+ CHT+   G+ + GP L G+FGR  G   G+ Y+ A  +  I W E+
Sbjct: 333 ITNGEKQFARKCSVCHTLSPDGRRRAGPTLFGVFGRMAGTLDGYPYSKALLDSDIIWSEE 392

Query: 64  TLME-YLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           T+   + E P    PGTKM    +K   +R DL+ +LK AT E
Sbjct: 393 TINRLFSEGPDIVTPGTKMPIQRMKNAQDRIDLVTFLKMATKE 435


Go to top
>tr|B1WM54|B1WM54_OLICA Copper-containing nitrite reductase (EC
           1.7.2.1).
          Length = 740

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +G++++ +KC  CH++E G ++  GP+L G+ G+K      ++++ A K  G+TW 
Sbjct: 164 GDAARGQQVY-KKCQACHSLEPG-RNGLGPSLAGIVGQKAADVPNYNFSAAMKGSGLTWD 221

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             TL  YL +P+K +PG KM F G+K + ER+ +IAYL K
Sbjct: 222 VATLDRYLADPQKVVPGNKMPFPGLKTEHERSAVIAYLVK 261


Go to top
>tr|Q2GDT8|Q2GDT8_NEOSM Cytochrome c.
          Length = 179

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGR-KTGQAAGFSYTDANKNKGITW 60
            ++E+GKK+  +KC  CHT EKGG +K GPNL  + G+ K      F Y+ A   KG TW
Sbjct: 70  ANIEEGKKL-AKKCVACHTFEKGGHNKVGPNLWDILGKNKAHLGDAFKYSKALLEKGGTW 128

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
             ++++  L  P +YI GTKM FAG+    + A+LIAYL+  ++ 
Sbjct: 129 DYNSMIHLLYKPAQYIKGTKMSFAGLSNPQDIANLIAYLRSLSDS 173


Go to top
>tr|B1DMR8|B1DMR8_9RHOO Cytochrome c class I.
          Length = 124

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+  FVQ CA CH    G  H  GPNLHG FGR      GF ++ A + +   W E  L 
Sbjct: 29  GESGFVQ-CAACHPAAAGQPHGVGPNLHGRFGRAIAGTPGFVFSRALRKREGVWTEAELD 87

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +L +P+ Y PGTKM +AG+K   +R  +I YLK
Sbjct: 88  RWLADPQAYAPGTKMAYAGLKDPAQRRAVIEYLK 121


Go to top
>tr|A3XC88|A3XC88_9RHOB Cytochrome c552.
          Length = 168

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  KG K+F +KCA CH +E G  + TGP+L+G+ GR    +AGF Y+ A    G TW  
Sbjct: 69  DAGKGAKVF-KKCAACHKLEDG-VNSTGPSLYGIVGRAQASSAGFGYSGALTALGGTWSA 126

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           + L  +L  P  Y  GT M F G++K+ +R +LIAYL  
Sbjct: 127 EELDAFLLKPSAYASGTSMSFNGLRKEKDRVNLIAYLDS 165


Go to top
>tr|A1HGU7|A1HGU7_BURPI Cytochrome c, class I precursor.
          Length = 224

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFS-YTDANKNKGITWG 61
           D+ +G +   + C  CH+   G +H TGP+L G+ GRK G A GF+ Y+DA K  G+ W 
Sbjct: 28  DLARGAQA-ARACMACHSFAPG-RHMTGPSLAGVLGRKAGTADGFARYSDALKQSGLVWD 85

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +  L  +L+NP   + G  M F GI     RADLIAYL+  + 
Sbjct: 86  KRNLDAWLKNPAALVSGNAMTFPGIADARTRADLIAYLEAVST 128


Go to top
>tr|A9HF42|A9HF42_METNO WD-40 repeat precursor.
          Length = 426

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 61/100 (61%), Gaps = 2/100 (2%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           E+G ++F + CA CHT+   G ++ GP LHG+FGR    A G++++ A +   I W  +T
Sbjct: 327 ERGAEVF-RACAACHTLTADGGNRAGPTLHGVFGRPIATAPGYTFSQALRRLDIVWNAET 385

Query: 65  LMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + +  E  P +Y PGTKM    I+  G+R  L+ +L++AT
Sbjct: 386 IAKLFEIGPSRYTPGTKMPEQTIRDPGDREALVRFLERAT 425


Go to top
>prf|2119163A|cytochrome c550
          Length = 97

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
            +C  CH VE  GKH  GP+L G+FG K G A G+ Y+D +   G+ W E  L +YL +P
Sbjct: 8   NQCKACHKVE-AGKHGVGPSLFGVFGAKAGHAEGYKYSDNHVKSGLVWDEANLSKYLADP 66

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLK 100
           K  +PG KM FAG+KK  +   ++ YLK
Sbjct: 67  KAPVPGNKMAFAGLKKPEDVKAVVDYLK 94


Go to top
>tr|Q1GDI1|Q1GDI1_SILST Cytochrome c class I.
          Length = 166

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV+KG K+F +KC+ CH ++  G   TGP+L G+ GR    +AGF Y+ A       W 
Sbjct: 67  ADVDKGAKVF-RKCSACHKLD--GTDATGPHLDGVVGRDIAASAGFGYSGALTALEGAWT 123

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            + L E+L  P  Y  GT M FAG+KK  +R +LIAYL+   N
Sbjct: 124 PEALNEFLLKPSDYASGTTMSFAGLKKVEDRVNLIAYLQTTAN 166


Go to top
>prf|3302410BVY|diheme cytochrome c
          Length = 345

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 62/99 (62%), Gaps = 4/99 (4%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWG 61
           E+G+K+F +KC  CH V +  K++ GP L+G+ G+  G   GF Y+    A   +G+ W 
Sbjct: 244 EEGEKVF-RKCKSCHQVGEDAKNRVGPILNGIVGKPAGAVEGFRYSKPMAAAGEEGLVWS 302

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L+ +L NPK Y+ GTKM FAG++K+ +   ++ YLK
Sbjct: 303 EAELIAFLANPKDYMRGTKMAFAGLRKEDDLVAVVEYLK 341


Go to top
>tr|Q16A43|Q16A43_ROSDO Diheme cytochrome c SoxD.
          Length = 345

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 62/99 (62%), Gaps = 4/99 (4%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWG 61
           E+G+K+F +KC  CH V +  K++ GP L+G+ G+  G   GF Y+    A   +G+ W 
Sbjct: 244 EEGEKVF-RKCKSCHQVGEDAKNRVGPILNGIVGKPAGAVEGFRYSKPMAAAGEEGLVWS 302

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L+ +L NPK Y+ GTKM FAG++K+ +   ++ YLK
Sbjct: 303 EAELIAFLANPKDYMRGTKMAFAGLRKEDDLVAVVEYLK 341


Go to top
>prf|2513497A|Cytochrome c-y
          Length = 174

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 62/98 (63%), Gaps = 6/98 (6%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGED 63
           G K+F  KCA CH V+  G   TGP+L+G+  R      GF+Y+DA   +  +  TW  +
Sbjct: 78  GHKVF-AKCAACHKVD--GSDATGPHLNGVVDRAVASVGGFAYSDAMVAHAAEAPTWTLE 134

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  ++ENPK ++PGTKM FAG+ K+ +RA+++AYL  
Sbjct: 135 ELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLAS 172


Go to top
>tr|O85794|O85794_RHOSH Cytochrome c-type cyt cy.
          Length = 174

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 62/98 (63%), Gaps = 6/98 (6%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITWGED 63
           G K+F  KCA CH V+  G   TGP+L+G+  R      GF+Y+DA   +  +  TW  +
Sbjct: 78  GHKVF-AKCAACHKVD--GSDATGPHLNGVVDRAVASVGGFAYSDAMVAHAAEAPTWTLE 134

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  ++ENPK ++PGTKM FAG+ K+ +RA+++AYL  
Sbjct: 135 ELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLAS 172


Go to top
>prf|3119377CNV|cytochrome c2
          Length = 122

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 56/98 (57%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F + C+ CH +    ++  GP L+G+ GR+ GQ   + YTDA KN G+ W 
Sbjct: 21  GDAEAGKAVFTRLCSGCHKIGPSARNAFGPPLNGIIGRQAGQQESYVYTDAMKNSGLVWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  Y+++P + +PGT+M    +       DL+ YL
Sbjct: 81  REELRTYIKDPGEVVPGTRMKLWWMGNDERMEDLLEYL 118


Go to top
>tr|Q48KK4|Q48KK4_PSE14 Cytochrome c2.
          Length = 122

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 56/98 (57%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD E GK +F + C+ CH +    ++  GP L+G+ GR+ GQ   + YTDA KN G+ W 
Sbjct: 21  GDAEAGKAVFTRLCSGCHKIGPSARNAFGPPLNGIIGRQAGQQESYVYTDAMKNSGLVWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  Y+++P + +PGT+M    +       DL+ YL
Sbjct: 81  REELRTYIKDPGEVVPGTRMKLWWMGNDERMEDLLEYL 118


Go to top
>tr|A9FV40|A9FV40_9RHOB Cytochrome c, class I.
          Length = 440

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F++KC+ CH +  G   K GP+L+ +FGR  G  AG+ Y++      I WGE T+ 
Sbjct: 339 GERQFMRKCSICHALGAGASRKAGPSLYNVFGRPAGTLAGYRYSEVLDGSDIIWGEATID 398

Query: 67  EYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
              +  P  YIPG+KM    I    +R DLIA+LK+AT
Sbjct: 399 ALFDLGPDHYIPGSKMPMQRITDPQDRRDLIAFLKRAT 436


Go to top
>tr|A3WHR7|A3WHR7_9SPHN Cytochrome c family protein.
          Length = 146

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV  G+++F   C  CHTVE GG    GPNL G+ GR+ G   G+ +T+A  +  ITW  
Sbjct: 34  DVAFGREVF-DMCDGCHTVEPGGTSAAGPNLFGVVGRRAGSLEGYLFTEALASSEITWDA 92

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             L  YL +P+ Y+PGT M    +++   R  LIAYL  
Sbjct: 93  AHLDAYLADPEGYVPGTDMERGTVREPEFRRALIAYLSN 131


Go to top
>tr|A9HRF3|A9HRF3_9RHOB Cytochrome c552.
          Length = 167

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           VE G K+F +KC+ CH + +G ++  GP L+G+ GR  G A G+ Y+D   +    W  +
Sbjct: 69  VEDGAKVF-RKCSACHKLVQG-ENVAGPYLYGVVGRDKGTAEGYGYSDTLASMEGAWTPE 126

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  +LE P  Y PGT M FAG++K  +RAD+IAYL  
Sbjct: 127 NLSGFLEKPSSYAPGTSMGFAGLRKVEDRADVIAYLDS 164


Go to top
>prf|3323271DRT|cytochrome c protein
          Length = 131

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 59/102 (57%), Gaps = 4/102 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGIT 59
           DV KG++ F +KC  CH V    K K GP L+G+ G K     G++Y++   A    G  
Sbjct: 23  DVAKGEQAF-KKCMACHAVGPEAKTKVGPPLNGIVGAKWAHFEGYAYSEDIKAGAAAGKV 81

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W E TL +YL NPK   P  KM F GIK + ERADLIAYL +
Sbjct: 82  WDEATLNDYLTNPKVLAPKGKMAFIGIKNEAERADLIAYLAQ 123


Go to top
>tr|Q0FNL8|Q0FNL8_9RHOB Cytochrome cy.
          Length = 169

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F  KC  CH ++  G   TGP+L+G+ GR+ G   GF Y+ A    G  W  
Sbjct: 72  DAGAGERVF-GKCRACHKLD--GSDATGPHLNGVVGREIGAVGGFGYSGALDQVGDVWSP 128

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L  +LE+P+   PGT M FAG+ K  +R +LIAYL+
Sbjct: 129 ENLFAFLESPRNTAPGTTMSFAGLNKPADRVNLIAYLQ 166


Go to top
>tr|A8I5P2|A8I5P2_AZOC5 Putative cytochrome c protein.
          Length = 131

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 59/102 (57%), Gaps = 4/102 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGIT 59
           DV KG++ F +KC  CH V    K K GP L+G+ G K     G++Y++   A    G  
Sbjct: 23  DVAKGEQAF-KKCMACHAVGPEAKTKVGPPLNGIVGAKWAHFEGYAYSEDIKAGAAAGKV 81

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W E TL +YL NPK   P  KM F GIK + ERADLIAYL +
Sbjct: 82  WDEATLNDYLTNPKVLAPKGKMAFIGIKNEAERADLIAYLAQ 123


Go to top
>tr|A4XEH9|A4XEH9_NOVAD Cytochrome c, class I precursor.
          Length = 127

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
            KG+++F  +C  CH+V   GK++ GP+L G+ GRK G+AAGF Y+ A      TW +  
Sbjct: 30  AKGQQVFKTQCGACHSVV-AGKNQIGPSLAGVVGRKAGKAAGFKYSPALAKASFTWDKAR 88

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           L +++  P K +PG +M + G+   G R  L+AYL
Sbjct: 89  LDKFVAGPSKAVPGNRMPYPGLADAGARQALLAYL 123


Go to top
>tr|A6FW74|A6FW74_9RHOB Cytochrome c552.
          Length = 351

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 65/98 (66%), Gaps = 2/98 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  +G+ ++ ++CA CH +E+G  +  GP L+G+ GR+ G   GF Y++  ++ G  W  
Sbjct: 252 DPSEGESLY-RRCAACHKLEEGA-NGVGPYLYGVVGREIGSVEGFRYSNVLQDMGGVWTA 309

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           D L  +LENPK Y PG KM FAG++K+ +RA +++YL+
Sbjct: 310 DELNAFLENPKDYAPGNKMSFAGLRKEEDRAAVVSYLQ 347



Go to top
 Score = 79.0 bits (193), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV KG++++  KCA CH +E+G  + TGP L+G+ GR    + GFSY+         W 
Sbjct: 73  ADVGKGERVY-NKCAACHKLEEGA-NGTGPYLYGVVGRDVAASQGFSYSGNLIAVNDVWT 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  +L NPK Y PGT M FAG+ K  +RA++IA+L
Sbjct: 131 PEELDAFLANPKGYAPGTTMGFAGLPKAEDRANVIAFL 168


Go to top
>tr|A9DG73|A9DG73_9RHIZ Cytochrome c2.
          Length = 226

 Score = 85.5 bits (210), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 11  FVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGITWGEDTLME 67
             + CA CH + +G KHK GP+L GLFGR  G  A F Y+D  +     G+ W  + L +
Sbjct: 21  LFKNCATCHEIGEGAKHKVGPHLDGLFGRPAGGLADFKYSDGMRRAGEDGLVWDAEALAQ 80

Query: 68  YLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           +LE P+ +I G +M + G+    +RA LI +L+ AT 
Sbjct: 81  FLEKPRGFIKGNRMSYRGMPDADDRATLIGWLETATQ 117


Go to top
>tr|A6FWD0|A6FWD0_9RHOB Diheme cytochrome c SoxD.
          Length = 403

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/103 (38%), Positives = 63/103 (61%), Gaps = 4/103 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT---DANKNKG 57
           M  VEKG+ +F +KCA CH V  G  ++ GP+L+G+ G++ G   GF Y+   +     G
Sbjct: 298 MALVEKGENVF-KKCAACHQVGDGATNRVGPHLNGIVGQQMGAVDGFRYSKTLEGMGADG 356

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + W  +TL E+L +P+ Y+ GTKM F G++   + A ++ YLK
Sbjct: 357 MVWNAETLAEFLADPRGYVKGTKMSFNGLRSDEDIAAVVEYLK 399


Go to top
>tr|A6FU36|A6FU36_9RHOB WD domain/cytochrome c family protein.
          Length = 441

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F++KC+ CH +      K GP LH LFGRK G  A + Y+D      I W +DT+ 
Sbjct: 334 GERQFMRKCSICHALTPPPSRKAGPTLHDLFGRKAGAIADYPYSDILATSDIIWSDDTID 393

Query: 67  EYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
              +  P  YIPG++M    I+ + +R DLIA+L+ AT
Sbjct: 394 ALFDMGPDHYIPGSRMPMQVIRAETDRQDLIAFLRTAT 431


Go to top
>pdb|1I6E_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A; FRAGMEN
          Length = 100

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           M D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W
Sbjct: 1   MADPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 58  TPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 97


Go to top
>pdb|1I6D_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A; FRAGMEN
          Length = 100

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           M D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W
Sbjct: 1   MADPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 58  TPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 97


Go to top
>pdb|1C7M_A|NOT | 1| 100|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A; FRAGMEN
          Length = 100

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           M D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W
Sbjct: 1   MADPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDW 57

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 58  TPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 97


Go to top
>tr|Q0F958|Q0F958_9RHOB Diheme cytochrome c SoxD.
          Length = 337

 Score = 85.1 bits (209), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGITW 60
           +  GKK+F +KC  CH V +G K+K+GP L+ + GRK G A  + Y+   K    +G  W
Sbjct: 235 INAGKKVF-KKCKACHAVGEGAKNKSGPQLYEIIGRKMGTANRYKYSKGFKVAAEEGRIW 293

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            E+ ++E+L  PKK+I GTKM F G+KK  +   ++AYLK   N
Sbjct: 294 TEELMVEFLRKPKKFIKGTKMSFGGLKKDKDLNAIVAYLKTQDN 337


Go to top
>tr|B0T1W7|B0T1W7_CAUSK Cytochrome c class I precursor.
          Length = 120

 Score = 85.1 bits (209), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
             G+ +F Q+C+ CH +      K GP L G+ GRK G A GF+Y+ A K  G+TW  +T
Sbjct: 23  PSGQAVFEQRCSICHALAPA-PGKMGPPLAGVVGRKAGTAPGFAYSAALKAYGVTWTPET 81

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           L  +++ P K +PGTKM+  G     +RA +IAYL
Sbjct: 82  LDAFVKAPSKTVPGTKMLL-GAPDDQQRAAVIAYL 115


Go to top
>tr|A6E559|A6E559_9RHOB Diheme cytochrome c SoxD.
          Length = 352

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGITW 60
           +  G+K+F +KC+ CH V +G  ++ GP L+G+ GR  G   GF Y+D  +     G+ W
Sbjct: 250 IAAGEKVF-KKCSACHQVGEGASNRVGPMLNGVMGRAAGSVEGFKYSDVLQTMAADGLIW 308

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            ++TL  +L NP+ ++ GTKM FAG+KK  +   + AYL
Sbjct: 309 TDETLTAFLANPRGFMKGTKMSFAGLKKDEDLTAISAYL 347


Go to top
>tr|A6E1S6|A6E1S6_9RHOB Cytochrome cy.
          Length = 392

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 2/99 (2%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G+K++ ++C  CH +E G K+  GP+L G+ GR      GF+Y+DA K    TW  + L
Sbjct: 296 EGEKLY-RRCGACHKLEDG-KNGAGPHLFGIVGRDIANVEGFAYSDALKGLEGTWTPEKL 353

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            +++ENP+ + PG +M F G+K + +RA+LI YL+ A N
Sbjct: 354 SDWIENPRAFAPGNRMGFPGLKDEADRANLIGYLQSAAN 392



Go to top
 Score = 64.3 bits (155), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF-SYTDANKNKGITW 60
            D   G+ +F + CA CH V  G ++K GP+L+G+ GR+ G  A + SY+ A       W
Sbjct: 72  ADPANGEGLF-RNCAACHAVVDG-ENKVGPHLYGVVGREVGGVADYGSYSGALTAVAQVW 129

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L  +LENPK Y PGT M +AG++K  +RADLIAYL +
Sbjct: 130 TPVELDAFLENPKGYAPGTSMGYAGMRKAEDRADLIAYLDQ 170


Go to top
>tr|Q1YHL0|Q1YHL0_9RHIZ Cytochrome c.
          Length = 445

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 5/107 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA----NKNKG 57
            D E G   F +KCA CH++EKGG +K GP+L  +  R       F Y+ A    ++   
Sbjct: 91  ADAEAGASQF-KKCAACHSIEKGGPNKVGPHLWDVVMRPIASVPDFGYSTAMQEFSEGGE 149

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + W  D L  +++NPK YIPGT M FAG+KK  +RA+LIAYL++  +
Sbjct: 150 VKWDFDHLYHFIKNPKGYIPGTAMGFAGLKKPEDRANLIAYLREQAD 196



Go to top
 Score = 78.2 bits (191), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD E GKK+F +KC  CH V +G K+K GP L+G+ G       G+S++ A      +  
Sbjct: 334 GDPEAGKKVF-RKCQACHAVGEGAKNKVGPELNGIVGEAIASVEGYSFSPALVAYAEEHP 392

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           TW  + L  +L +P+  + GTKM+F G+KK  + A++IAYL
Sbjct: 393 TWNVEELSAWLADPRGLVKGTKMVFPGLKKPEDVANVIAYL 433


Go to top
>prf|1911238A|cytochrome cy
          Length = 199

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G++ F + C  CH ++  GK+  GP+L+G+ GR T    GF Y+ A KN    W 
Sbjct: 99  GDAKAGEEKFNKTCKACHKID--GKNAVGPHLNGVIGRATATVEGFKYSTAMKNHVGNWT 156

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  YL +PK  +PGTKM F G+ +  +RA++IAYL
Sbjct: 157 PERLDIYLVSPKAEVPGTKMSFVGLPEAADRANVIAYL 194


Go to top
>sp|Q05389|CYCY_RHOCA Cytochrome c-type cyt cy.
          Length = 199

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD + G++ F + C  CH ++  GK+  GP+L+G+ GR T    GF Y+ A KN    W 
Sbjct: 99  GDAKAGEEKFNKTCKACHKID--GKNAVGPHLNGVIGRATATVEGFKYSTAMKNHVGNWT 156

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + L  YL +PK  +PGTKM F G+ +  +RA++IAYL
Sbjct: 157 PERLDIYLVSPKAEVPGTKMSFVGLPEAADRANVIAYL 194


Go to top
>tr|Q1MEU1|Q1MEU1_RHIL3 Putative exported cytochrome c precursor.
          Length = 129

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 59/103 (57%), Gaps = 5/103 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD   G  +F +KC  CH V     +K GP+L+GLFGRK G    ++Y+   K  G   +
Sbjct: 26  GDATAGAAVF-KKCVTCH-VADSDTNKVGPSLNGLFGRKAGTHPNYAYSAGMKAAGEGGL 83

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            W E  L +YL NPK  + GTKM F G+K   E  +LIAYLK+
Sbjct: 84  VWDETVLRDYLHNPKGKVKGTKMAFVGVKDDQEITNLIAYLKQ 126


Go to top
>tr|A3VES6|A3VES6_9RHOB Cytochrome cy.
          Length = 179

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (60%), Gaps = 3/97 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+++F  KC  CH ++  G + TGP+L G+ GR      GF Y+DA  + G  W  
Sbjct: 82  DAGAGERVF-NKCQSCHKLD--GSNGTGPHLDGVVGRAVAGVDGFGYSDAMASHGGDWTP 138

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + L  +LENP+  I GTKM F+G+K   +RA++IAYL
Sbjct: 139 EALDAFLENPRSNISGTKMTFSGLKDIEDRANVIAYL 175


Go to top
>prf|3101377CNV|WD domain/cytochrome c family protein
          Length = 449

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           ++ G++ F +KC+ CH +   G  + GP L+ +FGR+ G   G+ Y+D      I W E+
Sbjct: 343 MDNGERQFARKCSICHALTPEGGRRAGPTLYRVFGRRAGTLPGYLYSDTLAGSDIVWTEE 402

Query: 64  TLMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++    +  P  YIPG+KM    I    +RADLIAYL++AT
Sbjct: 403 SINSLFDLGPDHYIPGSKMPMQRITGAQDRADLIAYLRRAT 443


Go to top
>tr|Q5LSH5|Q5LSH5_SILPO WD domain/cytochrome c family protein.
          Length = 449

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           ++ G++ F +KC+ CH +   G  + GP L+ +FGR+ G   G+ Y+D      I W E+
Sbjct: 343 MDNGERQFARKCSICHALTPEGGRRAGPTLYRVFGRRAGTLPGYLYSDTLAGSDIVWTEE 402

Query: 64  TLMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           ++    +  P  YIPG+KM    I    +RADLIAYL++AT
Sbjct: 403 SINSLFDLGPDHYIPGSKMPMQRITGAQDRADLIAYLRRAT 443


Go to top
>tr|Q1NED3|Q1NED3_9SPHN Cytochrome c family protein.
          Length = 141

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 2/105 (1%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQ-AAGFSYTDANKNKGIT 59
           + D + G + F   CA CH   KG     GPNL+G++GR   Q +A +SYT A  +    
Sbjct: 38  VADADAGARKFAV-CAGCHKATKGSPDMGGPNLYGVYGRPMAQQSARYSYTAALLDARGR 96

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W   TL  ++ +P++ +PGTKMI+ G+    +RAD+IA+LK+  +
Sbjct: 97  WDARTLDAWMAHPQRVVPGTKMIYPGVSDPLDRADIIAFLKRQAD 141


Go to top
>prf|2705259WV|cytochrome c
          Length = 134

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 58/101 (57%), Gaps = 5/101 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGIT 59
           D   G+K+F  KC  CH +    K+K GP+LHG+ GR  G    F Y+DA       G+ 
Sbjct: 32  DAAAGEKVFT-KCQVCH-IANEDKNKIGPSLHGVIGRTAGTHPDFKYSDAMIAAGKSGVK 89

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           W E TL  YL +PK  + GTKM F G+K   + A++IAYLK
Sbjct: 90  WDEPTLTTYLHDPKAMVKGTKMTFPGLKNDADVANVIAYLK 130


Go to top
>tr|Q98LF0|Q98LF0_RHILO Cytochrome c.
          Length = 134

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 58/101 (57%), Gaps = 5/101 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGIT 59
           D   G+K+F  KC  CH +    K+K GP+LHG+ GR  G    F Y+DA       G+ 
Sbjct: 32  DAAAGEKVFT-KCQVCH-IANEDKNKIGPSLHGVIGRTAGTHPDFKYSDAMIAAGKSGVK 89

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           W E TL  YL +PK  + GTKM F G+K   + A++IAYLK
Sbjct: 90  WDEPTLTTYLHDPKAMVKGTKMTFPGLKNDADVANVIAYLK 130


Go to top
>tr|A3WR51|A3WR51_9BRAD Cytochrome c oxidase assembly protein ctag.
          Length = 310

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   GK++F ++C  CH ++    +K GP L  + GRK G   G+ Y+ A KN G+ W +
Sbjct: 196 DPMHGKQLFSERCTACHALDT---NKAGPLLGDVVGRKAGTVPGYHYSPALKNAGLVWSQ 252

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           D L  +L +PKK++PGT+M    +     R DL AYL+  + E
Sbjct: 253 DNLDRWLADPKKFVPGTRMP-VRVLDAPSRHDLFAYLQAVSEE 294


Go to top
>prf|3206257AKF|cytochrome c
          Length = 184

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 11  FVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK-GITWGEDTLMEYL 69
            V+ C  CHT E+GG  K GPNL+G+  R      GF+Y+ A K+K G  W    L  +L
Sbjct: 83  LVKPCLACHTTEEGGAKKVGPNLYGIVNRPIASEQGFNYSAALKSKAGGKWTFADLSSWL 142

Query: 70  ENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           ++PK Y  GT M + G+K + +RADLIAYL
Sbjct: 143 DDPKAYAKGTSMGYPGLKSESKRADLIAYL 172


Go to top
>tr|Q3SUR3|Q3SUR3_NITWN Cytochrome c, class I.
          Length = 184

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 11  FVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK-GITWGEDTLMEYL 69
            V+ C  CHT E+GG  K GPNL+G+  R      GF+Y+ A K+K G  W    L  +L
Sbjct: 83  LVKPCLACHTTEEGGAKKVGPNLYGIVNRPIASEQGFNYSAALKSKAGGKWTFADLSSWL 142

Query: 70  ENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           ++PK Y  GT M + G+K + +RADLIAYL
Sbjct: 143 DDPKAYAKGTSMGYPGLKSESKRADLIAYL 172


Go to top
>sp|Q92IT3|CYCM_RICCN Cytochrome c homolog.
          Length = 175

 Score = 84.3 bits (207), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVTGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +D+L  +L  P  Y PGTKM FAGI K  + AD+I +LK
Sbjct: 131 DDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLK 169


Go to top
>tr|B0T5J3|B0T5J3_CAUSK Cytochrome c class I precursor.
          Length = 126

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK  F Q CA CH VE    ++ GP+L G+FGRK G AA FSY+      G TW 
Sbjct: 24  GDPARGKAAFSQ-CAACHAVEPSA-NRVGPSLAGVFGRKKGSAAKFSYSSDLAAAGGTWD 81

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + +L  +L +PK   P  KM F  +     RADL+AYLK
Sbjct: 82  DKSLDAFLTDPKAAYPKAKM-FLKVANPQTRADLVAYLK 119


Go to top
>tr|A0NUL1|A0NUL1_9RHOB Cytochrome c.
          Length = 190

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---ITWG 61
           E G K+  +KCA CH   +GG +K GP L  + GRK G   GF Y+ A    G     W 
Sbjct: 81  EDGAKV-AKKCAACHDFTQGGANKVGPALWDVVGRKPGAHEGFGYSSAMTAFGEANPEWT 139

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            + L  +LE+PK +I GT M FAG++K  +RAD+IAYL++
Sbjct: 140 YEELDHFLESPKNFISGTTMGFAGLRKPEDRADIIAYLRE 179


Go to top
>tr|Q0FDA8|Q0FDA8_9RHOB Cytochrome c552.
          Length = 177

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 61/100 (61%), Gaps = 2/100 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           + D+ KG+K+F  KC  CH +  G  + TGP+L+ +  R  G   GF Y+         W
Sbjct: 77  VADISKGQKVF-SKCKACHKLADGA-NGTGPHLYNVVDRDIGSIDGFGYSAVLAGLEGGW 134

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               L  +L+NPKKY PGTKM FAGIKK+ +RA++IAYL+
Sbjct: 135 STAALDGFLKNPKKYAPGTKMGFAGIKKETDRANIIAYLQ 174


Go to top
>tr|A6WUU3|A6WUU3_OCHA4 Cytochrome c class I precursor.
          Length = 224

 Score = 84.0 bits (206), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D  +G+ +F ++CA CHT EKGG +K GP+L  +  R      GF Y+   K  G     
Sbjct: 72  DPARGETVF-KRCAACHTGEKGGANKVGPHLWDVVNRPAASVEGFGYSAPMKEFGAAGNK 130

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           W  + L ++L +PK +I GT M FAG KK  ERADLIAYL+  ++
Sbjct: 131 WDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSD 175


Go to top
>prf|3302410AVN|WD repeat protein
          Length = 442

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL- 65
           G++ F +KC+ CHT+E  GK + GP+L+GLFGR  G    + Y+       + W E+T+ 
Sbjct: 342 GERQFKRKCSICHTLEPDGKRRAGPSLYGLFGRAAGAIKDYPYSPTLATSDLVWTEETVD 401

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + +   P  YIPG+KM    I    +RADLI++L+ AT
Sbjct: 402 LLFDLGPDHYIPGSKMPMQRITGAQDRADLISFLQSAT 439


Go to top
>tr|Q16BI6|Q16BI6_ROSDO WD repeat protein.
          Length = 442

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL- 65
           G++ F +KC+ CHT+E  GK + GP+L+GLFGR  G    + Y+       + W E+T+ 
Sbjct: 342 GERQFKRKCSICHTLEPDGKRRAGPSLYGLFGRAAGAIKDYPYSPTLATSDLVWTEETVD 401

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + +   P  YIPG+KM    I    +RADLI++L+ AT
Sbjct: 402 LLFDLGPDHYIPGSKMPMQRITGAQDRADLISFLQSAT 439


Go to top
>tr|Q2LAG8|Q2LAG8_RHOSH Cytochrome cY.
          Length = 175

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGIT 59
           D   G+K++  KCA CH ++  G + TGP+L G+  R      GF+Y+DA   +      
Sbjct: 75  DPAAGQKVYA-KCAACHKLD--GSNATGPHLDGIIDRAVAGVDGFAYSDAMVAHAADAPA 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W  + L  +++NP+ ++PGTKM FAG+ K+ +RAD++AYL  
Sbjct: 132 WTVEELGAFVQNPRSHVPGTKMTFAGLPKEQDRADVVAYLAS 173


Go to top
>tr|A4WPW7|A4WPW7_RHOS5 Cytochrome c, class I precursor.
          Length = 175

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGIT 59
           D   G+K++  KCA CH ++  G + TGP+L G+  R      GF+Y+DA   +      
Sbjct: 75  DPAAGQKVYA-KCAACHKLD--GSNATGPHLDGIIDRAVAGVDGFAYSDAMVAHAADAPA 131

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W  + L  +++NP+ ++PGTKM FAG+ K+ +RAD++AYL  
Sbjct: 132 WTVEELGAFVQNPRSHVPGTKMTFAGLPKEQDRADVVAYLAS 173


Go to top
>tr|A3SJR4|A3SJR4_9RHOB WD domain/cytochrome c family protein.
          Length = 428

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F++KC+ CHT+E G   + GP L G+FGR+ G   G+ Y+   +   I W + ++ 
Sbjct: 325 GERQFMRKCSICHTLEPGPSRRAGPTLAGVFGRRAGTVPGYGYSPILQGSDIIWDDASID 384

Query: 67  EYLEN-PKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              ++ P  YIPG+KM    I+   +RADLIA+LK+A+ +
Sbjct: 385 ALFDSGPDHYIPGSKMPMQVIQNPEDRADLIAFLKQASRK 424


Go to top
>tr|A1B311|A1B311_PARDP Cytochrome c, class I precursor.
          Length = 176

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 79  DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 135

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 136 EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 173


Go to top
>tr|A6X352|A6X352_OCHA4 Cytochrome c class I precursor.
          Length = 130

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 5/102 (4%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGIT 59
           D   G+K+F ++C+ CHT E   K K GP+L+G+ GR      G+ Y+DA +    +G+ 
Sbjct: 28  DASAGEKLF-KRCSVCHTAE-ADKSKRGPSLNGVVGRTAASYPGYPYSDAMRKAAAEGLV 85

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W ED L  +L  P+  + GT M+FAG+ K+ +  ++IAYLK+
Sbjct: 86  WNEDELKSFLRKPQARVKGTWMVFAGLTKEKDLENMIAYLKQ 127


Go to top
>sp|Q4UKP6|CYCM_RICFE Cytochrome c homolog.
          Length = 175

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGREI-AKKCLVCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +D+L  +L  P  Y PGTKM FAGI K  + AD+I +LK
Sbjct: 131 DDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLK 169


Go to top
>prf|2116265A|cytochrome c552
          Length = 176

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 79  DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 135

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 136 EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 173


Go to top
>sp|P54820|CY552_PARDE Cytochrome c-552 (Cytochrome c552).
          Length = 176

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 79  DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 135

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 136 EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 173


Go to top
>tr|Q1YLF0|Q1YLF0_9RHIZ Possible cytochrome c with WD-repeat domain.
          Length = 450

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 58/103 (56%), Gaps = 1/103 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           G  + G+  F++KC+ CHT+     ++ GP L GLFGRK G   G+ Y+ A     I W 
Sbjct: 325 GTDDPGESEFLRKCSVCHTLTPDDGNRAGPTLFGLFGRKAGTVPGYPYSKALTESDIVWT 384

Query: 62  EDTLMEYLEN-PKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           EDT+ +  ++ P    PGTKM    +K    R  LIAYLK+AT
Sbjct: 385 EDTVSQLFDHGPDVVTPGTKMPVQRLKSVERRDALIAYLKRAT 427


Go to top
>tr|A8EY03|A8EY03_RICCK Cytochrome c.
          Length = 173

 Score = 83.6 bits (205), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A       W 
Sbjct: 70  ANADNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSSALSKLDGVWD 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +D+L  +L  P  Y PGTKM FAGI K  E AD+I +LK   ++
Sbjct: 129 DDSLFAFLHKPSSYAPGTKMSFAGISKLQEIADIILFLKTYVHD 172


Go to top
>tr|A9CVU4|A9CVU4_9RHIZ Putative cytochrome c transmembrane protein.
          Length = 184

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 5/107 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT----DANKNKG 57
            D  KG+ +F +KCA CHT + G  +K GP L  +  R   Q A F Y+    D ++   
Sbjct: 71  ADPAKGEGVF-KKCAACHTNDAGNGNKVGPGLWNIINRPVAQHADFKYSTALVDYSEGGA 129

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + W  + L  +L  PKKYI GT M FAG+KK  +RA+L+AYL+   +
Sbjct: 130 VAWTYERLSNFLAAPKKYISGTTMGFAGLKKIDDRANLLAYLRTVAD 176


Go to top
>prf|3302410BHY|cytochrome c552
          Length = 167

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           VE G K+F +KC+ CH + +G ++  GP L+G+ GR    A G+ Y+DA  +    W  +
Sbjct: 69  VEDGAKVF-RKCSACHKLVEG-ENVAGPYLYGVVGRDKAAAEGYGYSDALASMEGAWTPE 126

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  +LE P  Y PGT M FAG++K  +RA++IAYL  
Sbjct: 127 NLSGFLEKPSSYAPGTSMGFAGLRKVEDRANVIAYLDS 164


Go to top
>tr|Q9A7T8|Q9A7T8_CAUCR Cytochrome c family protein.
          Length = 110

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
             G+++F Q+C  CH++++    K GP L G+ GRK     G++Y+ A K  GITW  D 
Sbjct: 13  PSGQQLFEQRCGMCHSLQQA-PGKMGPPLAGVVGRKAASFPGYTYSAALKGSGITWTADK 71

Query: 65  LMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           L  Y + P K +PGTKM+  G     ERA +IAYL
Sbjct: 72  LDAYSKAPTKVVPGTKMLL-GAPNDAERAAVIAYL 105


Go to top
>tr|Q16AT5|Q16AT5_ROSDO Cytochrome c552.
          Length = 167

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           VE G K+F +KC+ CH + +G ++  GP L+G+ GR    A G+ Y+DA  +    W  +
Sbjct: 69  VEDGAKVF-RKCSACHKLVEG-ENVAGPYLYGVVGRDKAAAEGYGYSDALASMEGAWTPE 126

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            L  +LE P  Y PGT M FAG++K  +RA++IAYL  
Sbjct: 127 NLSGFLEKPSSYAPGTSMGFAGLRKVEDRANVIAYLDS 164


Go to top
>tr|B0BWS6|B0BWS6_RICRO Cytochrome c.
          Length = 175

 Score = 83.2 bits (204), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (57%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +D+L  +L  P  Y PGTKM FAGI K    AD+I +LK
Sbjct: 131 DDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLK 169


Go to top
>tr|A8GRC5|A8GRC5_RICRS Cytochrome c.
          Length = 175

 Score = 83.2 bits (204), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (57%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +D+L  +L  P  Y PGTKM FAGI K    AD+I +LK
Sbjct: 131 DDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLK 169


Go to top
>tr|A3W948|A3W948_9RHOB Cytochrome cy.
          Length = 376

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%), Gaps = 2/99 (2%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G+K+F ++C  CH +E G K+  GP+L G+ GR      GFSY+DA K     W  D L
Sbjct: 280 EGEKLF-RRCGACHKLEDG-KNGAGPHLFGIVGRDIANVDGFSYSDALKGLDGAWTVDQL 337

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             ++ENP+ + PG +M F G+K + +RA+LI YL+ + N
Sbjct: 338 SAWIENPRAFAPGNRMGFPGLKDEQDRANLIGYLQSSGN 376



Go to top
 Score = 77.4 bits (189), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/101 (42%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF-SYTDANKNKGITW 60
            D   G+ +F + CA CH V  G ++K GP+L+G+ GR  G  A + SY+ +       W
Sbjct: 73  ADPANGEGLF-RNCAACHAVADG-ENKVGPHLYGVVGRDVGSVASYGSYSGSLTEVAQVW 130

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
               L  +LENPK Y PGT M +AG++K  +RADLIAYL +
Sbjct: 131 TPVELNAFLENPKSYAPGTTMGYAGMRKAEDRADLIAYLDQ 171


Go to top
>tr|A3SZG8|A3SZG8_9RHOB Diheme cytochrome c SoxD.
          Length = 420

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGITW 60
           V  G+K+F +KC  CH V +G K+++GP L+ L GR  G   GF Y++  K    +G  W
Sbjct: 318 VAAGEKVF-KKCKACHQVGEGAKNRSGPQLNALIGRTFGSVDGFKYSNVFKAAMEEGRVW 376

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            E +L E+L  PK Y+ GTKM F+G+KK+ +   +  YLK
Sbjct: 377 DEASLSEFLTKPKDYMKGTKMSFSGLKKESDIKAVTEYLK 416


Go to top
>pdb|1QL4_D|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL4_C|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL4_B|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL4_A|1.5 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL3_D|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL3_C|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL3_B|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>pdb|1QL3_A|1.4 | 4|  99|N|MOL_ID: 1; MOLECULE: CYTOCHROME C552;
           CHAIN: A, B, C, D
          Length = 99

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G+K+F  KC  CH ++  G    GP+L+G+ GR      GF+Y+D  K  G  W  
Sbjct: 2   DPAAGEKVF-GKCKACHKLD--GNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTP 58

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           + L E+L NPK  + GTKM FAG+ K  +RA+LIAYL+
Sbjct: 59  EALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLE 96


Go to top
>tr|A8GMQ4|A8GMQ4_RICAH Cytochrome c.
          Length = 175

 Score = 82.8 bits (203), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +   G++I  +KC  CH+++K G +K GP+L  + GR  G  A + Y+ A       W 
Sbjct: 72  ANANNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKGSIADYKYSPALSKLSGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +D+L  +L  P  Y PGTKM FAGI +  + AD+I +LK   ++
Sbjct: 131 DDSLFAFLHKPSSYAPGTKMSFAGISRPRDIADVILFLKTYVHD 174


Go to top
>tr|A8TRQ2|A8TRQ2_9PROT WD domain/cytochrome c family protein.
          Length = 439

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F +KC  CHT+ +    + GP LHGL GR+ G   G+ Y+ A     + W  +T+ 
Sbjct: 341 GERQFERKCRICHTLSRDTARRAGPTLHGLMGRRAGTVDGYPYSGALTGIDLVWTAETVD 400

Query: 67  EYLEN-PKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +  E  P+ ++PGTKM    +    +RADLI YLK AT
Sbjct: 401 QLFEQGPENFVPGTKMPLQKMTNARDRADLIEYLKSAT 438


Go to top
>tr|Q1QHU4|Q1QHU4_NITHX Cytochrome c, class I.
          Length = 186

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + E+G  + V++C  CH  E+G   K GP+L+ +  R      GF+Y+ A K KG  W 
Sbjct: 78  ANAERGAGL-VKQCQICHNTEEGKGPKIGPDLYNIVDRPVASQPGFNYSAALKAKGGKWT 136

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
              L E++ +PK Y+ GT M FAG+K + +RADL+AYL
Sbjct: 137 FAELNEWINDPKGYVKGTSMSFAGLKSESKRADLVAYL 174


Go to top
>tr|A4EWF2|A4EWF2_9RHOB Cytochrome c552.
          Length = 167

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV KG K+F +KCA CH +E G  + TGP+L+ + GR  G   GF Y+ A   +  +W 
Sbjct: 67  ADVAKGAKVF-KKCAACHKLEDG-VNATGPSLYDVVGRTQGTEDGFGYSGALAGRDGSWT 124

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            + L  ++  P  Y  GT M F+G+KK+ +R +LIAYL  
Sbjct: 125 AEELDAFIAKPSAYASGTSMSFSGLKKQKDRVNLIAYLDS 164


Go to top
>prf|3323271BMU|cytochrome c
          Length = 155

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (60%), Gaps = 2/102 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQ-AAGFSYTDANKNKGITWG 61
           D   G ++F + C  CH+V + G +  GPNLHG+ G   G+ +  FSYT A +  G  W 
Sbjct: 53  DPAAGAQVF-RICGSCHSVGRAGGNLDGPNLHGVMGSLIGRNSPRFSYTAALQAVGGRWT 111

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            + +  +L++P+ + PGT M FAG++   +RAD+IAYL + T
Sbjct: 112 LERMDAWLKDPQAFAPGTSMGFAGLESARDRADVIAYLMRQT 153


Go to top
>tr|A8I0F1|A8I0F1_AZOC5 Cytochrome c.
          Length = 155

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (60%), Gaps = 2/102 (1%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQ-AAGFSYTDANKNKGITWG 61
           D   G ++F + C  CH+V + G +  GPNLHG+ G   G+ +  FSYT A +  G  W 
Sbjct: 53  DPAAGAQVF-RICGSCHSVGRAGGNLDGPNLHGVMGSLIGRNSPRFSYTAALQAVGGRWT 111

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            + +  +L++P+ + PGT M FAG++   +RAD+IAYL + T
Sbjct: 112 LERMDAWLKDPQAFAPGTSMGFAGLESARDRADVIAYLMRQT 153


Go to top
>tr|A9FY10|A9FY10_9RHOB Cytochrome c552.
          Length = 167

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV KG K+F +KC+ CH +E  G++ TGP L+G+  R    A GF Y+      G  W  
Sbjct: 68  DVGKGAKVF-KKCSACHKLE-AGENATGPYLYGVVDRPIAAADGFGYSATLAGLGGEWTA 125

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + L  +L  P +Y PGT M F+G+KK+ +R +LIAYL
Sbjct: 126 EELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYL 162


Go to top
>tr|A9EI07|A9EI07_9RHOB Cytochrome c552.
          Length = 167

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV KG K+F +KC+ CH +E  G++ TGP L+G+  R    A GF Y+      G  W  
Sbjct: 68  DVGKGAKVF-KKCSACHKLE-AGENATGPYLYGVVDRPIAAADGFGYSATLAGLGGEWTA 125

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + L  +L  P +Y PGT M F+G+KK+ +R +LIAYL
Sbjct: 126 EELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYL 162


Go to top
>tr|A3K9X0|A3K9X0_9RHOB Diheme cytochrome c SoxD.
          Length = 423

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           V  G+++F +KC  CH V  G K+KTGP L+G+ GR      GF+Y+ A +     W  +
Sbjct: 325 VATGERVF-KKCQACHQVGDGAKNKTGPILNGVVGRDIASVDGFNYSGAMEGMDGVWDSE 383

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            L  +L  P+ Y+ GTKM FAG++K  E   +I YLK
Sbjct: 384 ALHAFLAKPRDYVKGTKMAFAGLRKPEEIDAVIEYLK 420


Go to top
>tr|Q0FFM7|Q0FFM7_9RHOB Diheme cytochrome c SoxE.
          Length = 228

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGITW 60
           +  G K+F +KC  CH + +G K++ GP L+ +FGR  G   G  Y+ +      +G+ W
Sbjct: 22  ISSGAKLF-KKCQNCHQIGEGAKNRVGPQLNNIFGRTAGGLPGVKYSKSMVQAGEEGLVW 80

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
             +TL  ++ENPKK I  T+M F+G++K+ +R +L+ YL +
Sbjct: 81  NNETLNSFIENPKKLIVKTRMSFSGLRKEDDRKNLLLYLSE 121


Go to top
>tr|A3SZG7|A3SZG7_9RHOB Diheme cytochrome c SoxE.
          Length = 232

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGI 58
           GD ++G++++ +KCA CH V    +++ GP L+ +   K    A F Y+ A K     G+
Sbjct: 29  GDPKRGQQVY-KKCANCHMVGPDARNRVGPLLNNILAAKAAGVAEFRYSKAMKKAAEDGL 87

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W  +TL  +L NPK+ IP TKM F G+K + +R D+IAYL
Sbjct: 88  HWTPETLDTFLRNPKQMIPRTKMSFRGLKSEEDRIDVIAYL 128


Go to top
>tr|A8LLZ3|A8LLZ3_DINSH Cytochrome c class I precursor.
          Length = 126

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD E G+K+F  KC  CH +    K+K GP L+G+ G   GQ   F Y+D        G+
Sbjct: 23  GDPEAGEKVF-NKCKACHALGADAKNKVGPVLNGIIGAPAGQVPDFKYSDVLLEMAADGL 81

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            W E  L  YL  P+ ++ GTKM FAG++K+ +  +++AY+
Sbjct: 82  VWDEANLAAYLTKPRDFMKGTKMSFAGLRKEADVQNVLAYI 122


Go to top
>tr|A9HWA5|A9HWA5_9RHOB Diheme cytochrome c SoxD.
          Length = 345

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITWG 61
           E+G+K+F +KC  CH V +  K++ GP L+G+ G+  G   GF Y+    A   +G+ W 
Sbjct: 244 EEGEKVF-RKCKSCHQVGEDAKNRVGPILNGIVGKPAGAVEGFRYSKPMTAAGEEGLVWS 302

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L+ +L  PK Y+ GTKM FAG++K+ +   ++ YLK
Sbjct: 303 EAELIAFLAKPKDYMKGTKMAFAGLRKEDDLLAVVEYLK 341


Go to top
>tr|A8GWA2|A8GWA2_RICB8 Cytochrome c.
          Length = 173

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 70  ANADNGREI-AKKCLMCHSLDKDGPNKIGPHLWDVAGRPKASITDYKYSPALSALGGNWD 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +D+L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 129 DDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHD 172


Go to top
>sp|Q1RHX7|CYCM_RICBR Cytochrome c homolog.
          Length = 173

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 70  ANADNGREI-AKKCLMCHSLDKDGPNKIGPHLWDVAGRPKASITDYKYSPALSALGGNWD 128

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +D+L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 129 DDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHD 172


Go to top
>tr|Q02A35|Q02A35_SOLUE Cytochrome c, class I precursor.
          Length = 118

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           GK +F ++C  CH +++    K+GP L G++GR+ G  AGF+Y+++ +  G+ W   TL 
Sbjct: 24  GKDLFERRCTGCHAIDR---EKSGPRLAGVYGRRAGAIAGFTYSESLRKSGVVWDRATLD 80

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            +L NP+  +P   M F  +  +GER  +I YL++ ++
Sbjct: 81  RWLANPESVVPDNDMPFR-LADEGERQAIIEYLRQISS 117


Go to top
>tr|Q7PB75|Q7PB75_RICSI Cytochrome c.
          Length = 175

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G+ I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGRAI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           +D+L  +L  P  Y PGTKM FAGI K  +  D+I +LK
Sbjct: 131 DDSLFAFLHKPSSYAPGTKMSFAGISKPQDITDVILFLK 169


Go to top
>tr|B0UML1|B0UML1_METS4 Cytochrome c class I precursor.
          Length = 429

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 5   EKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDT 64
           E+G ++F + CA CHT+   G ++ GP LHG+FGR+   A G+ Y++A +   + W  +T
Sbjct: 330 ERGAEVF-RACAACHTLGPDGGNRAGPTLHGIFGRRIATAPGYGYSEALRRLDLVWSPET 388

Query: 65  LMEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           +    E  P +Y PGTKM    I    +R  L+ +L++AT
Sbjct: 389 VARLFEVGPSRYTPGTKMPEQTIGDPRDREALVRFLERAT 428


Go to top
>tr|Q1GJM9|Q1GJM9_SILST Cytochrome c class I.
          Length = 427

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F++KC+ CH +    + + GP+L GLFGR  G   G+ Y+D      I WG +T+ 
Sbjct: 324 GERQFMRKCSVCHDLVATEQRRAGPHLAGLFGRPAGSLPGYRYSDTLAQSDIIWGAETID 383

Query: 67  EYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
              +  P  YIPG+KM    I    +R DLI YLK AT
Sbjct: 384 ALFDLGPDHYIPGSKMPMQRITAPTDRQDLIDYLKTAT 421


Go to top
>tr|Q0G146|Q0G146_9RHIZ WD domain/cytochrome c family protein.
          Length = 464

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 61/103 (59%), Gaps = 2/103 (1%)

Query: 3   DVEK-GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           DVE  G++ F++KC+ CHT+     ++ GP L+GLFGRK G   G++Y++A KN  I W 
Sbjct: 355 DVEDPGEREFLRKCSVCHTLTPDDANRAGPTLYGLFGRKAGTVDGYAYSEALKNSDIIWT 414

Query: 62  EDTLMEYLEN-PKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            +T+    ++ P    PGTKM    +K    R  L+ YL +AT
Sbjct: 415 AETVGRLFDDGPDVMTPGTKMPIQRLKSVERRDALVDYLARAT 457


Go to top
>prf|3403416LG|cytochrome c
          Length = 187

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
           GD E G+KIF Q CA CHT  +    + GP L  +  R    AAGF+Y+ A + +    W
Sbjct: 69  GDFENGRKIFRQ-CAICHTSGRNQAGRVGPVLWEIVDRPLASAAGFAYSRALRAHSDQKW 127

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
              TL  YL +P++  PGT M F GIK   +RADL+ YL+  ++
Sbjct: 128 DFVTLDRYLRSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSD 171


Go to top
>tr|A9IMZ7|A9IMZ7_BART1 Cytochrome c.
          Length = 187

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
           GD E G+KIF Q CA CHT  +    + GP L  +  R    AAGF+Y+ A + +    W
Sbjct: 69  GDFENGRKIFRQ-CAICHTSGRNQAGRVGPVLWEIVDRPLASAAGFAYSRALRAHSDQKW 127

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
              TL  YL +P++  PGT M F GIK   +RADL+ YL+  ++
Sbjct: 128 DFVTLDRYLRSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSD 171


Go to top
>tr|A9EJC8|A9EJC8_9RHOB WD domain/cytochrome c family protein.
          Length = 440

 Score = 81.6 bits (200), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G++ F++KC+ CH +      K GP+L+ +FGR  G  AG+ Y++      I WGE T+ 
Sbjct: 339 GERQFMRKCSICHALGPEDSRKAGPSLYNVFGRPAGTLAGYRYSEVLDGSDIIWGEATID 398

Query: 67  EYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
              +  P  YIPG+KM    I    +R DLIA+LK+AT
Sbjct: 399 ALFDLGPDHYIPGSKMPMQRITDPQDRRDLIAFLKRAT 436


Go to top
>prf|3017390KR|cytochrome c
          Length = 175

 Score = 81.6 bits (200), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +   G++I V+KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 72  ANANHGREI-VKKCLMCHSLDKDGPNKLGPHLWNIVGRSKASITDYKYSFAISKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++ L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 131 DENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHD 174


Go to top
>sp|Q68XB6|CYCM_RICTY Cytochrome c homolog.
          Length = 175

 Score = 81.6 bits (200), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +   G++I V+KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 72  ANANHGREI-VKKCLMCHSLDKDGPNKLGPHLWNIVGRSKASITDYKYSFAISKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++ L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 131 DENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHD 174


Go to top
>tr|Q1QQF8|Q1QQF8_NITHX Cytochrome c oxidase assembly protein
           CtaG/Cox11.
          Length = 308

 Score = 81.6 bits (200), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   GK++F ++C  CH ++     K GP L G+ GRK G   G+ Y+ A KN G+ W  
Sbjct: 194 DPLHGKQLFSERCTACHALDAD---KAGPRLGGVVGRKAGALPGYHYSPALKNAGLVWSR 250

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           D L  +L +PKK +PG++M    +     R D++AYL+    E
Sbjct: 251 DNLEHWLADPKKLVPGSRMP-VRVLDAPSRHDIVAYLQTVGQE 292


Go to top
>prf|2705259GYM|cytochrome c
          Length = 215

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK--NKGIT 59
            +VE G  +F +KC  CH+ EKGG +K GP+L  L  R   +  GF+Y+   K  +KG T
Sbjct: 70  ANVEAGAAVF-KKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGMKEFSKGGT 128

Query: 60  --WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             W  D +  ++ +PKK++ GT M FAG+ K  +RA++IAYL+  ++
Sbjct: 129 EKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSD 175


Go to top
>tr|Q98BN4|Q98BN4_RHILO Cytochrome c.
          Length = 215

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK--NKGIT 59
            +VE G  +F +KC  CH+ EKGG +K GP+L  L  R   +  GF+Y+   K  +KG T
Sbjct: 70  ANVEAGAAVF-KKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGMKEFSKGGT 128

Query: 60  --WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             W  D +  ++ +PKK++ GT M FAG+ K  +RA++IAYL+  ++
Sbjct: 129 EKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSD 175


Go to top
>prf|3103367GCF|cytochrome c
          Length = 122

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G++I+  +C  CH +     ++TGP   GLFGR+ G    + Y+DA +  GI W   TL
Sbjct: 19  RGEEIYA-RCLACHAL---AYNRTGPRHCGLFGRRAGSLPDYGYSDAMRESGIVWDAATL 74

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             +L  P + +PGT M +AGI    ERA LI +L++ + 
Sbjct: 75  DRFLAAPTRVVPGTTMGYAGIPDPAERAALIEWLRETSR 113


Go to top
>tr|Q5NZC9|Q5NZC9_AZOSE Putative cytochrome c.
          Length = 122

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G++I+  +C  CH +     ++TGP   GLFGR+ G    + Y+DA +  GI W   TL
Sbjct: 19  RGEEIYA-RCLACHAL---AYNRTGPRHCGLFGRRAGSLPDYGYSDAMRESGIVWDAATL 74

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
             +L  P + +PGT M +AGI    ERA LI +L++ + 
Sbjct: 75  DRFLAAPTRVVPGTTMGYAGIPDPAERAALIEWLRETSR 113


Go to top
>tr|A9HVI3|A9HVI3_9RHOB Cytochrome c family protein.
          Length = 133

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGI 58
           GD   G+K+F +KC  CH V +G ++K GP L+G+          F Y+D   A  ++G 
Sbjct: 26  GDAAAGEKVF-RKCKACHAVGEGAENKIGPALNGVVDAAVAGKPDFKYSDTLMAMASEGK 84

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           TW  + L  +LE P+ Y  GTKM FAG++K+ +R ++IAYL
Sbjct: 85  TWTPEELAGFLEKPRNYAKGTKMAFAGLRKEEDRMNVIAYL 125


Go to top
>prf|3018370CKT|ORF
          Length = 179

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
           G++E G+KIF Q CA CHT  +    + GP L G+  R      GF+Y+   + N    W
Sbjct: 69  GNLENGRKIFRQ-CALCHTSGQNEVGRVGPALWGVVDRPLAATTGFAYSRVLRANSDKRW 127

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
              TL  YL++P++  PGT M F GIK   +RADL+ YL+  ++
Sbjct: 128 DFVTLDRYLQSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSD 171


Go to top
>tr|Q6G0M3|Q6G0M3_BARQU Putative uncharacterized protein.
          Length = 179

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
           G++E G+KIF Q CA CHT  +    + GP L G+  R      GF+Y+   + N    W
Sbjct: 69  GNLENGRKIFRQ-CALCHTSGQNEVGRVGPALWGVVDRPLAATTGFAYSRVLRANSDKRW 127

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
              TL  YL++P++  PGT M F GIK   +RADL+ YL+  ++
Sbjct: 128 DFVTLDRYLQSPREAFPGTIMSFRGIKNDQDRADLLLYLRSLSD 171


Go to top
>tr|Q2CDL8|Q2CDL8_9RHOB Cytochrome c552.
          Length = 175

 Score = 80.9 bits (198), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           + D   G++++ + C  CH +E G  + TGP LHG+ GR+     GF+Y+ A ++    W
Sbjct: 74  VADAAAGEELW-RNCRACHALEPG-VNGTGPTLHGVVGREVAAVEGFNYSGALRDVVEVW 131

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             + L  +L +P+ Y PGT M + G+++  +RADLIAYL
Sbjct: 132 TPEELDGFLADPRGYAPGTAMTYGGMRRAEDRADLIAYL 170


Go to top
>tr|A9H3Q9|A9H3Q9_9RHOB WD repeat protein.
          Length = 442

 Score = 80.9 bits (198), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 1/98 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL- 65
           G++ F +KC+ CHT+E  GK + GP+L+ LFGR  G    + Y+       + W E+T+ 
Sbjct: 342 GERQFKRKCSICHTLEPDGKRRAGPSLYDLFGRAAGAIKDYPYSPTLATSDLIWTEETVD 401

Query: 66  MEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + +   P  YIPG+KM    I    +RADLI++L+ AT
Sbjct: 402 LLFDLGPDHYIPGSKMPMQRITGAQDRADLISFLQSAT 439


Go to top
>tr|A5CFT9|A5CFT9_9ZZZZ Putative uncharacterized protein.
          Length = 167

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D  +G+ + +Q C  CHT+E+GG +  GPNL G+F R  G A  + Y++     G  W  
Sbjct: 64  DTGRGEALSMQ-CRACHTLEQGGANVLGPNLFGVFSRTAGSAPDYPYSEVLAAGGFIWTP 122

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
             L  +L  P  ++PG +M F G+    +R  +IAYL + T+ 
Sbjct: 123 RALDAWLAQPFAFLPGNRMSFPGLTDGNDRNAVIAYLLQYTDS 165


Go to top
>prf|2705259FYN|cytochrome c
          Length = 116

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 4/100 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+  F  +C  CH++ + G    GP L  ++GR+ G  AGF Y+ A + K   W 
Sbjct: 14  GDAISGRGYFEDRCTGCHSIVRNG---FGPRLGDVYGRRVGSVAGFQYSQALRQKRFVWS 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E +L  +L  P +++PGT+M  + I  +  RAD+IAYLK 
Sbjct: 71  EKSLDSWLSGPGQFLPGTRMGIS-IADQQIRADIIAYLKS 109


Go to top
>tr|Q98D16|Q98D16_RHILO Cytochrome c-1.
          Length = 116

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 4/100 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   G+  F  +C  CH++ + G    GP L  ++GR+ G  AGF Y+ A + K   W 
Sbjct: 14  GDAISGRGYFEDRCTGCHSIVRNG---FGPRLGDVYGRRVGSVAGFQYSQALRQKRFVWS 70

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E +L  +L  P +++PGT+M  + I  +  RAD+IAYLK 
Sbjct: 71  EKSLDSWLSGPGQFLPGTRMGIS-IADQQIRADIIAYLKS 109


Go to top
>tr|A3TVM5|A3TVM5_9RHOB Cytochrome cy.
          Length = 173

 Score = 80.5 bits (197), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            DV+ G ++F  KC  CH ++  G + TGP L G+ GR  G   G+SY+ A      TW 
Sbjct: 74  ADVDSGARVF-GKCKACHKID--GSNATGPYLDGVVGRAVGGVDGYSYSGALVEVAETWT 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
            + L  ++E+PK + PGTKM FAGI+K G+RADL+AYL+ 
Sbjct: 131 PENLNAFIEDPKGFAPGTKMSFAGIRKAGDRADLVAYLQS 170


Go to top
>tr|Q47E63|Q47E63_DECAR Cytochrome c, class I precursor.
          Length = 140

 Score = 80.5 bits (197), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            D      I  ++CA CH ++     +TGP   GL GR+ G   GF+Y+ A +   + W 
Sbjct: 29  ADAHARGAIIYERCAACHALQTD---RTGPRHCGLIGRRAGSVPGFAYSPAMRQSRLIWS 85

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E  L  +++ P  ++PGT M + G+K   ER DL+A+L++
Sbjct: 86  EANLDRFIKAPMAFMPGTAMGYDGVKNDAERHDLLAFLRQ 125


Go to top
>tr|Q5ZQM8|Q5ZQM8_9RHIZ SoxD protein.
          Length = 379

 Score = 80.5 bits (197), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
            DV  G+K F  +C  CH V +G  ++ GP+L+ L GR+ G   G+SY+ A    G   +
Sbjct: 28  ADVAAGEKAF-GRCKACHAVGEGASNRVGPHLNELIGREAGTVDGYSYSAAMTQAGEGGL 86

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            W E +L  +L NPK  + GTKM FAG+KK  +  ++IAYL   + E
Sbjct: 87  VWDEASLKGFLANPKGLVKGTKMAFAGLKKDQDLENVIAYLATFSAE 133


Go to top
>tr|Q1MGD7|Q1MGD7_RHIL3 Putative cytochrome c precursor.
          Length = 124

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 4/100 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV  G+K F Q+C+ CH+     + K GP L G+ GR  G   G  Y+ A K  G+ W 
Sbjct: 26  GDVALGQKAF-QRCSACHSTTD--QKKAGPGLGGVVGRAAGSVEGVRYSAAMKASGLVWD 82

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E TL  +L  P++ +P T M   G+ K  +R ++IAYLK 
Sbjct: 83  EATLDRFLAAPREVVPTTTMTV-GVPKPEDRLNIIAYLKS 121


Go to top
>tr|A4G3C5|A4G3C5_HERAR Putative cytochrome c.
          Length = 122

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV  GK  F  KCA CH V +  +   GP L+G+ GR  G    F Y+ A  N  I W 
Sbjct: 22  GDVIAGKAAFA-KCASCHQVGRSARGVFGPQLNGIVGRPAGATKDFKYSAAMMNSRIVWS 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           E +L  +L++P   +P  KM F GI    +  DL+AYL +
Sbjct: 81  EASLRAFLKSPNDVVPENKMRFFGIGNDRQIDDLLAYLSQ 120


Go to top
>tr|Q11E81|Q11E81_MESSB Cytochrome c, class I precursor.
          Length = 133

 Score = 80.1 bits (196), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD   GK +F + C  CH  EK  ++  GP L G+ GR         Y+ A K+ GI W 
Sbjct: 30  GDAVAGKAVFEKNCQVCHEAEKM-RNGAGPYLLGVVGRPAASTDFPRYSQALKDSGIVWD 88

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
            + +  ++  PK ++PGT+M F G+K + E A+++AYL + +
Sbjct: 89  PENISAFISGPKAFVPGTRMFFTGLKTEEEIANVVAYLVEVS 130


Go to top
>prf|3302410AQA|cytochrome c family protein
          Length = 133

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGI 58
           GD   G+K+F +KC  CH V +G ++K GP L+G+          F Y+D   A   +G 
Sbjct: 26  GDAAAGEKVF-RKCKACHAVGEGAENKIGPALNGIVDAAVAGNPDFKYSDVLMAMAAEGK 84

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           TW  + L  +LE P+ Y  GTKM FAG++K+ +R ++IAYL
Sbjct: 85  TWTPEELSGFLEKPRNYAKGTKMAFAGLRKEEDRMNVIAYL 125


Go to top
>tr|Q16BT6|Q16BT6_ROSDO Cytochrome c family protein.
          Length = 133

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 4/101 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGI 58
           GD   G+K+F +KC  CH V +G ++K GP L+G+          F Y+D   A   +G 
Sbjct: 26  GDAAAGEKVF-RKCKACHAVGEGAENKIGPALNGIVDAAVAGNPDFKYSDVLMAMAAEGK 84

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           TW  + L  +LE P+ Y  GTKM FAG++K+ +R ++IAYL
Sbjct: 85  TWTPEELSGFLEKPRNYAKGTKMAFAGLRKEEDRMNVIAYL 125


Go to top
>tr|Q1MN22|Q1MN22_RHIL3 Putative cytochrome c precursor.
          Length = 187

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (57%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT----DANKNKG 57
            D + G+ +F +KC  CH   KGG +K GPNL G+  R     AGF+Y+    D +K   
Sbjct: 69  ADAKAGETVF-KKCQACHDGTKGGPNKVGPNLFGVVDRPIASHAGFAYSAPMKDFSKGGS 127

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             W  + L ++L  PKK IPGT M FAG+ K  ERA++I YL
Sbjct: 128 EKWTFEYLNKFLLAPKKDIPGTAMGFAGLAKDQERANVILYL 169


Go to top
>tr|Q8W8K8|Q8W8K8_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 42/45 (93%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQAAGF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAAGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|A3K3D5|A3K3D5_9RHOB Cytochrome c552.
          Length = 170

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           DV  G+K+F  KC  CH ++  G + TGP+L G+ GR  G   GF+Y+      G  W  
Sbjct: 72  DVGDGEKVF-GKCRACHKID--GSNATGPHLDGVVGRPIGSVGGFNYSGNLNQVGDAWTP 128

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           + L  +LE+PK   PGT M F G+ K  +RA +IA+L+  +
Sbjct: 129 EHLNTFLESPKAAAPGTTMSFNGLSKPEDRAAVIAFLQSVS 169


Go to top
>tr|A8LJ39|A8LJ39_DINSH Cytochrome c class I precursor.
          Length = 342

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGITW 60
           V  G+K+F ++CA CH V +G +++ GP L G+ G+  G  A F Y+ A      +G+ W
Sbjct: 241 VAAGEKVF-KRCAACHQVGEGAQNRVGPVLTGIVGQPAGAVADFRYSKALEERAEEGLIW 299

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             +TL  +L  PK+++P  KM F G++K  + A ++A+L+
Sbjct: 300 DAETLKAFLAKPKEFLPRNKMSFPGLRKDEDLAAIVAFLQ 339


Go to top
>tr|A8TP70|A8TP70_9PROT Probable sulfite oxidase cytochrome subunit.
          Length = 368

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKG---I 58
           GD EKG  +F +KCA CH V    K++ GP+L+GL GR  G   GF Y+ A ++ G   +
Sbjct: 24  GDPEKGAAVF-KKCAACHQVGDDAKNRIGPHLNGLIGRTAGALDGFKYSKAMQDAGAGGM 82

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            W  +TL  YLE+P+  + GT+M F G+K   +RAD IAYL + + +
Sbjct: 83  VWTVETLDAYLESPRTAVKGTRMAFPGLKDADDRADAIAYLAEYSKQ 129


Go to top
>tr|A6SVY9|A6SVY9_JANMA Cytochrome c2.
          Length = 122

 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GDV  GK++F  KCA CH V    +   GP L+G+ GR  G    + Y+ A  +  + W 
Sbjct: 22  GDVAAGKRVFA-KCANCHQVGPSARGNFGPQLNGIVGRTAGTTKDYKYSAAMSSSRVVWT 80

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           E  L  ++++    IPG KM F GI  + +  DL+AYL+
Sbjct: 81  EANLRAFIQSTNDVIPGNKMRFFGISDEKQITDLLAYLQ 119


Go to top
>tr|A8F114|A8F114_RICM5 Cytochrome c.
          Length = 175

 Score = 79.3 bits (194), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            + + G++I  +KC  CH+++K G +K GP+L  + GR     A + Y+ A    G  W 
Sbjct: 72  ANADNGREI-AKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSPALSKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           +D+L  +L  P  Y  GTKM FAGI K  + AD+I +LK   ++
Sbjct: 131 DDSLFVFLHKPSSYALGTKMSFAGISKPQDIADVILFLKTYVHD 174


Go to top
>tr|A3WUV0|A3WUV0_9BRAD Cytochrome c, class I.
          Length = 179

 Score = 79.3 bits (194), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNK-GITW 60
             VE+G  + V++C  CH  E+G   K GP+L+G+  R      GF+Y+ A K+K G  W
Sbjct: 70  ASVERGAGL-VKQCQICHNTEEGAGKKIGPDLYGVVNRPIASVEGFNYSAALKSKAGGKW 128

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
               L ++L +PK Y  GT M F G+K + +RADL+AYL
Sbjct: 129 TFAELNKWLNDPKAYAKGTSMSFTGLKSETKRADLVAYL 167


Go to top
>tr|A0NY63|A0NY63_9RHOB WD domain/cytochrome c family protein.
          Length = 488

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           ++  G++ F +KC+ CH +      K GP LH +FGR+ G    + Y+       I W E
Sbjct: 379 EMSNGERQFARKCSICHALTGDTARKAGPTLHNIFGRRAGTVPDYPYSATLSGSDIVWSE 438

Query: 63  DTLME-YLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKA 102
            T+ + +L+ P  YIPG+KM    I ++ +R DLI YLK A
Sbjct: 439 TTIDQLFLDGPDHYIPGSKMPMQRIVEQQDRDDLIDYLKSA 479


Go to top
>tr|B2ID00|B2ID00_9RHIZ Cytochrome c class I precursor.
          Length = 143

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 1/103 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D EKGK+ F+  C  CHT E G  ++ GPNL G++GRK G  A F+Y+ A K+    W E
Sbjct: 40  DAEKGKQQFLTSCGVCHTAEPGAGNRQGPNLAGVYGRKVGSIADFNYSPALKSGTWVWNE 99

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            TL  +L N ++  PGT M +     +  R  +I YL   + E
Sbjct: 100 TTLDPWLTNSQEAHPGTFMNYRQANAEKRRL-VIDYLSSLSKE 141


Go to top
>tr|B0IZY4|B0IZY4_RHILT Cytochrome c class I.
          Length = 255

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT----DANKNKG 57
            D + G+ +F +KC  CH   KGG +K GPNL G+  R     AGF+Y+    D +K   
Sbjct: 137 ADAKAGETVF-KKCQACHDGTKGGPNKVGPNLFGVVDRPIASHAGFAYSAPMKDFSKGSS 195

Query: 58  ITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             W  + L ++L  PKK +PGT M FAG+ K  +RA++I YL
Sbjct: 196 EKWTFEYLNKFLLAPKKDVPGTAMGFAGLAKDQDRANVILYL 237


Go to top
>prf|2424426KY|cytochrome c
          Length = 175

 Score = 79.3 bits (194), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +   G++I  +KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 72  ANANHGREI-AKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSFAISKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++ L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 131 DENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHD 174


Go to top
>sp|Q9ZDS2|CYCM_RICPR Cytochrome c homolog.
          Length = 175

 Score = 79.3 bits (194), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
            +   G++I  +KC  CH+++K G +K GP+L  + GR       + Y+ A    G  W 
Sbjct: 72  ANANHGREI-AKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSFAISKLGGVWD 130

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
           ++ L  +L  P  Y PGTKM FAGI K  + AD+I +LK   ++
Sbjct: 131 DENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHD 174


Go to top
>prf|3207409EP|cytochrome c
          Length = 187

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (59%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN--KGIT 59
            D + G+ +F +KC  CH   KGG +K GPNL G+  R      GF+Y+ A K+  KG +
Sbjct: 69  ADAKAGEAVF-KKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFAYSSAMKDFSKGSS 127

Query: 60  --WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             W  + L ++L  PKK +PGT M FAG+ K  +RA++I YL
Sbjct: 128 EKWTFENLNKFLLAPKKDVPGTAMGFAGLPKDQDRANVILYL 169


Go to top
>tr|Q2KDX8|Q2KDX8_RHIEC Cytochrome-c protein.
          Length = 187

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (59%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN--KGIT 59
            D + G+ +F +KC  CH   KGG +K GPNL G+  R      GF+Y+ A K+  KG +
Sbjct: 69  ADAKAGEAVF-KKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFAYSSAMKDFSKGSS 127

Query: 60  --WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             W  + L ++L  PKK +PGT M FAG+ K  +RA++I YL
Sbjct: 128 EKWTFENLNKFLLAPKKDVPGTAMGFAGLPKDQDRANVILYL 169


Go to top
>tr|A7IG94|A7IG94_XANP2 Cytochrome c class I precursor.
          Length = 132

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 56/102 (54%), Gaps = 4/102 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGIT 59
           DV KG+  F +KC  CH +    K K GP L+G+ G K     G++Y+   K+    G  
Sbjct: 24  DVAKGETTF-KKCMACHAIGPDAKVKVGPPLNGIVGAKWAHFEGYAYSADIKDGAAAGKV 82

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W E TL  Y+ NPK   P  KM FAG+K   ER DLIA+L +
Sbjct: 83  WDEATLDNYISNPKVLAPKGKMAFAGVKNDDERKDLIAFLAQ 124


Go to top
>tr|A7IMT2|A7IMT2_XANP2 Cytochrome c class I precursor.
          Length = 130

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 56/102 (54%), Gaps = 4/102 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGIT 59
           DV KG+  F +KC  CH +    K K GP L+G+ G K     G++Y+   K+    G  
Sbjct: 22  DVAKGETTF-KKCMACHAIGPDAKVKVGPPLNGIVGAKWAHFEGYAYSADIKDGAAAGKV 80

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           W E TL  Y+ NPK   P  KM FAG+K   ER DLIA+L +
Sbjct: 81  WDEATLDNYISNPKVLAPKGKMAFAGVKNDDERKDLIAFLAQ 122


Go to top
>prf|3311456MKC|cytochrome c2
          Length = 144

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 64/116 (55%), Gaps = 19/116 (16%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGI 58
           GD  KG++IF Q C  CH +    K+  GP L G+ GR TG   GF+Y+D NK+    G+
Sbjct: 25  GDPAKGEQIFKQ-CMTCHRIGPDAKNAVGPVLTGVVGRATGTYPGFAYSDLNKHAGEAGL 83

Query: 59  TWGEDTLMEYLENP----KKYIP----------GTKMIFAGIKKKGERADLIAYLK 100
            W ED + EYL +P    KKY+            TKM+F  +  + +R D+IAYLK
Sbjct: 84  VWTEDNIFEYLPDPSAFLKKYLTEKGKADQAAGSTKMVFK-LANEQQRKDVIAYLK 138


Go to top
>tr|A5EQ92|A5EQ92_BRASB Cytochrome c2.
          Length = 144

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 64/116 (55%), Gaps = 19/116 (16%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGI 58
           GD  KG++IF Q C  CH +    K+  GP L G+ GR TG   GF+Y+D NK+    G+
Sbjct: 25  GDPAKGEQIFKQ-CMTCHRIGPDAKNAVGPVLTGVVGRATGTYPGFAYSDLNKHAGEAGL 83

Query: 59  TWGEDTLMEYLENP----KKYIP----------GTKMIFAGIKKKGERADLIAYLK 100
            W ED + EYL +P    KKY+            TKM+F  +  + +R D+IAYLK
Sbjct: 84  VWTEDNIFEYLPDPSAFLKKYLTEKGKADQAAGSTKMVFK-LANEQQRKDVIAYLK 138


Go to top
>tr|A3S8H0|A3S8H0_9RHOB Cytochrome c552.
          Length = 169

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF-SYTDANKNKGITWG 61
           D  KG+K+F +KC+ CH VE G  +  GP L+G+ GR    A G+ SY+ A +    TW 
Sbjct: 69  DPAKGEKVF-RKCSACHKVEDGA-NAVGPYLYGVVGRPVDSADGYASYSGALEKVAETWT 126

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            + L  +L  P  + PGT M FAG+ K  +RA++IAYL    N
Sbjct: 127 PENLNAFLTKPAGFAPGTTMGFAGLPKIEDRANVIAYLDSLDN 169


Go to top
>tr|Q0FI42|Q0FI42_9RHOB Diheme cytochrome c SoxD.
          Length = 408

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 7   GKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLM 66
           G+K+F +KC  CH V +G K++TGP L+ + GR+ G   GF Y+      G  W  + L 
Sbjct: 313 GEKVF-RKCKACHQVGEGAKNRTGPQLNAVVGREIGGLDGFKYSGTLAEMGGVWDAEALH 371

Query: 67  EYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            +L +P+ Y  GTKM FAG+KK  +   ++ YLK
Sbjct: 372 GFLADPRGYAKGTKMAFAGLKKDEDIDAVVEYLK 405


Go to top
>tr|Q8WBF2|Q8WBF2_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|Q8WBF0|Q8WBF0_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|Q8WBD8|Q8WBD8_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|Q8W920|Q8W920_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|Q8W919|Q8W919_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|Q8W918|Q8W918_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWSKDTLFEY 45


Go to top
>tr|A9D291|A9D291_9RHIZ Cytochrome cy.
          Length = 126

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (58%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDA---NKNKGI 58
           GD   G K+F +KCA CH V    K++ GP+L G+  R      G+ Y+ A   + ++  
Sbjct: 21  GDAVAGAKVF-KKCAACH-VATEAKNRVGPHLVGIVDRPMASVEGYKYSKAMIAHADEVP 78

Query: 59  TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           TW  + L  YL  P+K + GTKM FAG+KK  + A++IAYLK
Sbjct: 79  TWTVEALDAYLRAPRKVVKGTKMAFAGLKKDDDVANVIAYLK 120


Go to top
>tr|A3VPW9|A3VPW9_9PROT Cytochrome C.
          Length = 227

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGED 63
           VE+G++     C  CHT ++G  +  GPNL G+ GR      GFSY+ A +     W  +
Sbjct: 83  VERGQRA-AGLCGSCHTFQEGEPNGIGPNLWGIVGRDIASHGGFSYSSALQGLEGDWTYE 141

Query: 64  TLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
            L  YLEN + Y+PGT+M    ++K+ +RADL+AYL   +N+
Sbjct: 142 RLDPYLENSQAYVPGTQMAQM-VRKEEKRADLLAYLGSLSND 182


Go to top
>prf|3121275GAR|cytochrome c2
          Length = 118

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTG-QAAGFSYTDANKNKGITWGEDTLMEYLEN 71
             C  CH VE G  +  GP+LHG+ G K G  AAGF Y+ A    G +W +  L  Y+ N
Sbjct: 28  SACKTCHKVEAGA-NGIGPSLHGVAGSKAGTAAAGFKYSPALTGWGKSWDDANLAAYIAN 86

Query: 72  PKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           PK  IPG KM+FAG+K   + + ++ YLK
Sbjct: 87  PKDTIPGNKMVFAGLKNPADVSAMVEYLK 115


Go to top
>tr|Q2W1P5|Q2W1P5_MAGMM Cytochrome C2, iso-2.
          Length = 118

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTG-QAAGFSYTDANKNKGITWGEDTLMEYLEN 71
             C  CH VE G  +  GP+LHG+ G K G  AAGF Y+ A    G +W +  L  Y+ N
Sbjct: 28  SACKTCHKVEAGA-NGIGPSLHGVAGSKAGTAAAGFKYSPALTGWGKSWDDANLAAYIAN 86

Query: 72  PKKYIPGTKMIFAGIKKKGERADLIAYLK 100
           PK  IPG KM+FAG+K   + + ++ YLK
Sbjct: 87  PKDTIPGNKMVFAGLKNPADVSAMVEYLK 115


Go to top
>tr|Q8WBE2|Q8WBE2_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWNKDTLFEY 45


Go to top
>tr|Q8W892|Q8W892_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWNKDTLFEY 45


Go to top
>tr|Q8W891|Q8W891_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWNKDTLFEY 45


Go to top
>tr|A8LQB4|A8LQB4_DINSH Cytochrome c class I precursor.
          Length = 174

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D   G++++ Q C  CH +E G  +  GP LHG+  R    A G++Y+DA  ++   W  
Sbjct: 76  DAGAGERLWRQ-CQACHKLEAGA-NGVGPYLHGIVDRPKHAADGYAYSDALLSQDGAWTP 133

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
           + +  +LENP++Y PGTKM + G+    +RA+LIAYL
Sbjct: 134 ENISAFLENPREYAPGTKMAYRGMPDVEDRANLIAYL 170


Go to top
>tr|B1M6T4|B1M6T4_METRJ Cytochrome c class I precursor.
          Length = 428

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 2/99 (2%)

Query: 6   KGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTL 65
           +G ++F   CA CHT+      + GP L GLFGR+     G+ Y+D+ K   I W  +T+
Sbjct: 328 RGAEVF-GACAACHTLTSDAGERAGPTLAGLFGRRIASVPGYRYSDSLKRLDIVWTPETV 386

Query: 66  MEYLE-NPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
               E  P +Y PGTKM    I    +RA LI +L++AT
Sbjct: 387 SRLFEIGPARYTPGTKMPEQTIGNDADRAALIEFLERAT 425


Go to top
>prf|3008327W|cytochrome c2
          Length = 144

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 65/116 (56%), Gaps = 19/116 (16%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGI 58
           GD  KG+++F Q C  CH +    K+  GP L G+ GR TG A GF+Y++ NK+    G+
Sbjct: 25  GDAAKGEQVFKQ-CMTCHRIGPDAKNAVGPVLTGVVGRPTGTAPGFAYSELNKHAGEAGL 83

Query: 59  TWGEDTLMEYLENP----KKYIP----------GTKMIFAGIKKKGERADLIAYLK 100
            W +D + EYL +P    KKY+            TKM+F  +  + +R D++AYLK
Sbjct: 84  VWTDDNIFEYLADPNAFLKKYLTEKGKADQATGSTKMVFK-LANEQQRKDVVAYLK 138


Go to top
>tr|Q8VUB4|Q8VUB4_BRASO Cytochrome C2.
          Length = 144

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 65/116 (56%), Gaps = 19/116 (16%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGI 58
           GD  KG+++F Q C  CH +    K+  GP L G+ GR TG A GF+Y++ NK+    G+
Sbjct: 25  GDAAKGEQVFKQ-CMTCHRIGPDAKNAVGPVLTGVVGRPTGTAPGFAYSELNKHAGEAGL 83

Query: 59  TWGEDTLMEYLENP----KKYIP----------GTKMIFAGIKKKGERADLIAYLK 100
            W +D + EYL +P    KKY+            TKM+F  +  + +R D++AYLK
Sbjct: 84  VWTDDNIFEYLADPNAFLKKYLTEKGKADQATGSTKMVFK-LANEQQRKDVVAYLK 138


Go to top
>tr|Q8WBF7|Q8WBF7_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQAAGF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAAGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8WBF5|Q8WBF5_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQAAGF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAAGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>prf|3018370JW|ORF
          Length = 183

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 2/105 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
            ++E G+KIF Q C  CHT  +   ++ GP L G+  R       F+Y+   + N    W
Sbjct: 66  ANIENGRKIFRQ-CGLCHTSGRHESNRVGPALWGIIDRPLAAKTDFAYSRVLRANSDQRW 124

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              TL  YL++P++  PGT M F GIK   +RADL+ YL+  +++
Sbjct: 125 DFMTLDRYLQSPREAFPGTIMFFRGIKNDQDRADLLLYLRGLSDD 169


Go to top
>tr|Q6G4U5|Q6G4U5_BARHE Putative uncharacterized protein.
          Length = 183

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 2/105 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK-NKGITW 60
            ++E G+KIF Q C  CHT  +   ++ GP L G+  R       F+Y+   + N    W
Sbjct: 66  ANIENGRKIFRQ-CGLCHTSGRHESNRVGPALWGIIDRPLAAKTDFAYSRVLRANSDQRW 124

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE 105
              TL  YL++P++  PGT M F GIK   +RADL+ YL+  +++
Sbjct: 125 DFMTLDRYLQSPREAFPGTIMFFRGIKNDQDRADLLLYLRGLSDD 169


Go to top
>sp|P00093|CYC2_RHOPH Cytochrome c2.
          Length = 113

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANK---NKGI 58
           GD   G+KI   KC  CH + KGG  K GP L G+FGR TG  AG+SY+        KG 
Sbjct: 2   GDAAVGEKIAKAKCTACHDLNKGGPIKVGPPLFGVFGRTTGTFAGYSYSPGYTVMGQKGH 61

Query: 59  TWGEDTLMEYLENPKKYI--------PGTKMIFAGIKKKGERADLIAYL 99
           TW ++ L  YL +PK Y+          +KMIF  ++K  + A++IAYL
Sbjct: 62  TWDDNALKAYLLDPKGYVQAKSGDPKANSKMIFR-LEKDDDVANVIAYL 109


Go to top
>tr|Q8WBE1|Q8WBE1_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFPYSDSNKNKGVTWNKDTLFEY 45


Go to top
>prf|3401267DBM|cytochrome c
          Length = 161

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKT-GPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
            D  KG+    + C +CH +      +T  P L G+ GR+     GF Y+ A K     W
Sbjct: 46  ADPAKGEVAAERHCHRCHALTGSPDARTVAPPLRGVIGRERASVPGFHYSHALKEMHGQW 105

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             D+L  +L  P  + PGT+M FAG+K   ERAD+IAYL+
Sbjct: 106 DTDSLNAWLFRPSAFAPGTRMSFAGVKDDRERADIIAYLR 145


Go to top
>tr|Q0BQL2|Q0BQL2_GRABC Cytochrome c.
          Length = 161

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKT-GPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
            D  KG+    + C +CH +      +T  P L G+ GR+     GF Y+ A K     W
Sbjct: 46  ADPAKGEVAAERHCHRCHALTGSPDARTVAPPLRGVIGRERASVPGFHYSHALKEMHGQW 105

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             D+L  +L  P  + PGT+M FAG+K   ERAD+IAYL+
Sbjct: 106 DTDSLNAWLFRPSAFAPGTRMSFAGVKDDRERADIIAYLR 145


Go to top
>tr|Q8WBG2|Q8WBG2_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBG1|Q8WBG1_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBF8|Q8WBF8_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBF3|Q8WBF3_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBF1|Q8WBF1_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBE5|Q8WBE5_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBE3|Q8WBE3_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBE0|Q8WBE0_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBD9|Q8WBD9_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W966|Q8W966_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W965|Q8W965_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W964|Q8W964_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W963|Q8W963_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W962|Q8W962_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W961|Q8W961_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W960|Q8W960_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q2N7K5|Q2N7K5_ERYLH Cytochrome c family protein.
          Length = 150

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 44/87 (50%)

Query: 14  KCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPK 73
            CA CH  + G     GPNL+G+ GR+ G    F Y+DA  +    W E  L  YL +P 
Sbjct: 60  ACAACHVAKAGAASGIGPNLYGVVGREAGALPNFGYSDAMASADFVWDEARLNAYLGDPN 119

Query: 74  KYIPGTKMIFAGIKKKGERADLIAYLK 100
             +PGT M+   +    +R  +IAYL 
Sbjct: 120 GVVPGTSMVAGAVSDAAKREAIIAYLA 146


Go to top
>tr|Q1QND2|Q1QND2_NITHX Cytochrome c, class I precursor.
          Length = 149

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 58/98 (59%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
             VE+G +I  ++C  CH V +G   K GP+L+G+  R      GF+Y+ A K KG  W 
Sbjct: 41  ASVERGARI-AKQCEICHNVVEGKGPKVGPDLYGVVNRPIASMPGFNYSAALKAKGGKWT 99

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
              L ++L +P+  + GT M FAG+K + +RA +IAYL
Sbjct: 100 FAELDKWLTDPRADVKGTHMTFAGLKSESKRAAVIAYL 137


Go to top
>tr|A8STD6|A8STD6_RIFPA Cytochrome c (Fragment).
          Length = 51

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/45 (77%), Positives = 39/45 (86%)

Query: 55 NKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
          NKGI W  +TL  YLENPKKYIPGTKMIFAG+KKK +RADL+AYL
Sbjct: 2  NKGIVWSPETLDTYLENPKKYIPGTKMIFAGLKKKNDRADLVAYL 46


Go to top
>tr|A3STD1|A3STD1_9RHOB Cytochrome c552.
          Length = 169

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF-SYTDANKNKGITWG 61
           D  KG+K+F +KC+ CH  E G  +  GP L+G+ GR    A G+ SY+ A +    TW 
Sbjct: 69  DPAKGEKVF-RKCSACHKAEDGA-NAVGPYLYGVVGRPVDSADGYASYSGALEKSAETWT 126

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
            + L  +L  P  + PGT M FAG+ K  +RA++IAYL    N
Sbjct: 127 PENLNAFLTKPAGFAPGTTMGFAGLPKIEDRANVIAYLDSLDN 169


Go to top
>prf|3221371QRP|cytochrome c
          Length = 130

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
           ++CA CH V +G   + GP+L  + GR+ G   GF Y+ A ++ GI W   +L  +L++P
Sbjct: 38  ERCAACHGVAQG-DQRVGPSLGDVLGRQAGSMEGFRYSSAMRSSGIVWTAQSLELFLKDP 96

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           ++ +PG +M F+G+     R  ++ YL++
Sbjct: 97  QRAVPGNRMAFSGVDDAPTRDAIVDYLRE 125


Go to top
>tr|Q13IC5|Q13IC5_BURXL Putative cytochrome c.
          Length = 130

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
           ++CA CH V +G   + GP+L  + GR+ G   GF Y+ A ++ GI W   +L  +L++P
Sbjct: 38  ERCAACHGVAQG-DQRVGPSLGDVLGRQAGSMEGFRYSSAMRSSGIVWTAQSLELFLKDP 96

Query: 73  KKYIPGTKMIFAGIKKKGERADLIAYLKK 101
           ++ +PG +M F+G+     R  ++ YL++
Sbjct: 97  QRAVPGNRMAFSGVDDAPTRDAIVDYLRE 125


Go to top
>tr|Q8WBE8|Q8WBE8_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFPYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|A5WCQ2|A5WCQ2_PSYWF Cytochrome c, class I.
          Length = 169

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD +KG+K++   C QCHT+ + G +K GP L G++   + Q   + Y++A  +    W 
Sbjct: 58  GDAQKGEKLYEDNCTQCHTI-RPGSNKKGPQLLGVYMAPSAQLKDYKYSEAMSHANWVWD 116

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             TL +Y+ +P+  +P T+M+   +    +R D+IAYL
Sbjct: 117 AKTLDKYIADPEAVLPDTRMLSDPMPNTQDRQDIIAYL 154


Go to top
>tr|Q8WBD7|Q8WBD7_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+DANKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDANKNKGVTWTKDALFEY 45


Go to top
>tr|A9E7B1|A9E7B1_9RHOB Diheme cytochrome c SoxD.
          Length = 366

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYT---DANKNKGITW 60
           ++ G+K F +KC  CH +    K++ GP L+G+     G   GF Y+   +A    G+ W
Sbjct: 264 IKAGEKAF-RKCKSCHQIGAKAKNRVGPVLNGIVDGPAGAVEGFRYSKAMEAAAEDGLVW 322

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
             D L  +L +PK Y+ GTKM F G++K+ +   LIAYL+ A+
Sbjct: 323 SHDALTSFLGDPKGYMKGTKMSFPGVRKEEDIEALIAYLRDAS 365


Go to top
>tr|Q8W8L0|Q8W8L0_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 77.0 bits (188), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 41/45 (91%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA+GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQASGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8WBE4|Q8WBE4_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.6 bits (187), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+F RK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFSRKSGQAPGFAYSDSNKNKGVTWNKDTLFEY 45


Go to top
>tr|Q8W7D0|Q8W7D0_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.6 bits (187), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+F RK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFSRKSGQAPGFAYSDSNKNKGVTWNKDTLFEY 45


Go to top
>tr|B1CGP0|B1CGP0_RHILT Cytochrome c class I precursor.
          Length = 188

 Score = 76.6 bits (187), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 5/102 (4%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN--KGIT 59
            D + G+ +F +KC  CH   KGG +K GPNL G+  R      GF Y+ A K+  KG +
Sbjct: 70  ADAKAGETVF-KKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFGYSAAMKDFSKGSS 128

Query: 60  --WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
             W  + L ++L  PKK +PGT M FAG+ K  +RA++I YL
Sbjct: 129 EKWTFEFLNKFLMAPKKDVPGTAMGFAGLAKDQDRANVILYL 170


Go to top
>tr|Q7BQQ3|Q7BQQ3_XANAU Putative cytochrome C protein.
          Length = 164

 Score = 76.6 bits (187), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKN---KGIT 59
           DV KG+  F +KC  CH +    K K GP L+G+ G K     G++Y+   K+    G  
Sbjct: 24  DVAKGETAF-KKCMACHAIGPDAKVKVGPPLNGIVGAKWAHFEGYAYSADIKDGAAAGKV 82

Query: 60  WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKAT 103
           W E TL  Y+ NPK   P  KM FAGIK + ER DLIA    +T
Sbjct: 83  WDEATLDNYITNPKVLAPKGKMAFAGIKNEDERKDLIASSPSST 126


Go to top
>tr|Q0G805|Q0G805_9RHIZ Cytochrome c family protein.
          Length = 134

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGIT--- 59
           D E G+++F ++C  CH V +G  +  GP L+G+  R      G+SY++ N N+      
Sbjct: 25  DAEAGEQVF-KRCQACHKVGEGAANGIGPQLNGIMNRAPASIEGYSYSN-NFNEWAADKE 82

Query: 60  -WGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
            W ++ +  +L +P+  + GTKM FAG+KK+ E A++IAYLK
Sbjct: 83  QWDDELMSTWLADPRGTVQGTKMAFAGLKKEDELANVIAYLK 124


Go to top
>tr|Q89SL2|Q89SL2_BRAJA Cytochrome c2.
          Length = 128

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWG 61
           GD  +GK +F + C  CH    G  +K GP+L  +  RK      F+Y+DA K     W 
Sbjct: 28  GDPARGKAVFQRTCENCHAAVIG-VNKVGPSLWNVIDRKPAIVPDFAYSDAMKANKQAWT 86

Query: 62  EDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             TL  YL +P+  + G KM F G+    +RA++IAYL+
Sbjct: 87  PTTLDAYLADPRGDVHGVKMFFKGLPNPADRANVIAYLQ 125


Go to top
>tr|Q8WBF4|Q8WBF4_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8W967|Q8W967_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8W959|Q8W959_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8W958|Q8W958_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8W957|Q8W957_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8W956|Q8W956_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALFEY 45


Go to top
>tr|Q8WBE9|Q8WBE9_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+F RK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFSRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8WBE7|Q8WBE7_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+F RK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFSRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|Q8W8D5|Q8W8D5_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+F RK+GQA GF+Y+D+NKNKG+TW +DTL EY
Sbjct: 1  GGKHKVGPNLNGIFSRKSGQAPGFAYSDSNKNKGVTWTKDTLFEY 45


Go to top
>tr|A3SQX3|A3SQX3_9RHOB Diheme cytochrome c SoxD.
          Length = 366

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 4   VEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTD---ANKNKGITW 60
           V +G+K+F +KC  CH V    K+++GP L+G+  R      GF Y+    +    G+TW
Sbjct: 264 VAEGEKLF-RKCKACHQVGDKAKNRSGPILNGVVDRAAATVDGFKYSKGMVSAAEDGLTW 322

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYL 99
            + TL  +L  PK  + GTKM FAG KK  E   +IAYL
Sbjct: 323 DDATLRAFLTKPKDVVKGTKMSFAGFKKDAELDAIIAYL 361


Go to top
>tr|A3WF82|A3WF82_9SPHN Diheme cytochrome c SoxD.
          Length = 153

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%)

Query: 1   MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW 60
           +G +  GK  F   CA CH V+ G     GP+L+G+ GR       F+Y++A +  GITW
Sbjct: 49  VGLLTVGKTAFEANCAICHAVDVGASSGIGPSLNGVVGRPAASLDDFAYSNAMQASGITW 108

Query: 61  GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
               +  Y+ NP   +PGT M    +    +R  + AYL+
Sbjct: 109 TTGEIDAYIANPTAMLPGTSMAGVMVTNAQDRNAITAYLE 148


Go to top
>sp|P00087|CYC21_RHOMO Cytochrome c2 iso-1.
          Length = 100

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 13  QKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENP 72
            +C  CH+++  GK+  GP+L G +GRK G A  + Y+ A+   G+T  +  L +YL NP
Sbjct: 9   NQCKACHSID-AGKNGVGPSLSGAYGRKVGLAPNYKYSPAHLASGMTIDDAMLTKYLANP 67

Query: 73  KKYIPGTKM--IFAGIKKKGERADLIAYLK 100
           K+ IPG KM   F G+K   + A +IAYLK
Sbjct: 68  KETIPGNKMGAAFGGLKNPADVAAVIAYLK 97


Go to top
>tr|Q0ASL3|Q0ASL3_MARMM Cytochrome c, class I.
          Length = 236

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (55%), Gaps = 1/102 (0%)

Query: 3   DVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGE 62
           D+  G++   ++CA CH+ ++GG +  GPNL G+ G       GF Y+ A ++    W  
Sbjct: 77  DIGAGERA-ARRCAACHSFDQGGANGVGPNLWGIVGADIASHDGFGYSGALESIEGGWTY 135

Query: 63  DTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN 104
           + L  ++E+P  Y PGT M F G+     R +LIAYL+  ++
Sbjct: 136 EALDAFIESPAGYAPGTAMSFRGLGNDDTRLELIAYLRSLSD 177


Go to top
>tr|A9CFY9|A9CFY9_AGRT5 Cytochrome c2.
          Length = 166

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 6/103 (5%)

Query: 2   GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGF-SYTDANKNKGI-- 58
           GD   G+K+F  +C+ CH+V+   + + GP+L G+ GR     A +  Y+ A K+ G   
Sbjct: 60  GDAAHGEKVF-SRCSTCHSVD-APRTRMGPHLMGVVGRPMAAVADYGHYSQALKDAGAAG 117

Query: 59  -TWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLK 100
             W ED L +++ +PKK IPG  M F G+  + +  DLIAYLK
Sbjct: 118 RVWTEDELQKFIASPKKAIPGNAMRFFGLWSETDIVDLIAYLK 160


Go to top
>tr|Q8WBF6|Q8WBF6_9CARA Cytochrome C (Fragment).
          Length = 45

 Score = 75.9 bits (185), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (88%)

Query: 24 GGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEY 68
          GGKHK GPNL+G+FGRK+GQA GF+Y+D+NKNKG+TW +D L EY
Sbjct: 1  GGKHKVGPNLNGIFGRKSGQAPGFAYSDSNKNKGVTWTKDALYEY 45


Go to top
>prf|