受付番号は、【20080705150215_19465】です。


************** [align] **************

options = -align -type=protein -matrix=blosum -gapdist=8 -maxdiv=40 -outorder=aligned -gapopen=10 -gapext=0.2 -pwmatrix=blosum -pwgapopen=10 -pwgapext=0.1

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Pearson
Sequence 1: rat_hemoglobin_alpha_P01946         142 aa
Sequence 2: mouse_hemoglobin_alpha_unrevie      142 aa
Sequence 3: polar_bear_hemoglobin_alpha_P6      142 aa
Sequence 4: giant_panda_hemoglobin_alpha_P      142 aa
Sequence 5: sheep_hemoglobin_alpha_Q28743       142 aa
Sequence 6: hippopotamus_hemoglobin_alpha_      141 aa
Sequence 7: harbor_seal_hemoglobin_alpha_P      141 aa
Sequence 8: chimpanzee_hemoglobin_alpha_P6      142 aa
Sequence 9: human_hemoglobin_alpha_P69905       142 aa
Sequence 10: bovine_hemoglobin_alpha_P01966      142 aa
Sequence 11: Bornean_orangutan_hemoglobin_a      142 aa
Sequence 12: Lowland_gorilla_hemoglobin_alp      140 aa
Sequence 13: Atlantic_bottle-nosed_dolphin_      141 aa
Sequence 14: Nile_crocodile_hemoglobin_alph      141 aa
Sequence 15: Eastern_gray_kangaroo_hemoglob      141 aa
Sequence 16: Domestic_duck_hemoglobin_alpha      142 aa
Sequence 17: Minke_whale_hemoglobin_alpha_P      142 aa
Sequence 18: American_alligator_hemoglobin_      142 aa
Sequence 19: Chicken_hemoglobin_alpha_P0199      142 aa
Sequence 20: Domestic_pigeon_hemoglobin_alp      142 aa
Sequence 21: Western_painted_turtle_hemoglo      141 aa
Sequence 22: Galapagos_giant_tortoise_hemog      142 aa
Start of Pairwise alignments
Aligning...

== Aligned score is not displayed ==

Start of Multiple Alignment
There are 21 groups
Aligning...

== Aligned score is not displayed ==

Alignment Score 154414


query.aln
CLUSTAL W (1.83) multiple sequence alignment


rat_hemoglobin_alpha_P01946         MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVS
mouse_hemoglobin_alpha_unrevie      MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVS
polar_bear_hemoglobin_alpha_P6      MVLSPADKSNVKATWDKIGSHAGEYGGEALERTFASFPTTKTYFPHFDLS
giant_panda_hemoglobin_alpha_P      MVLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS
harbor_seal_hemoglobin_alpha_P      -VLSPADKTNVKATWDKIGGHAGEYGGEALERTFTAFPTTKTYFPHFDLS
chimpanzee_hemoglobin_alpha_P6      MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLS
human_hemoglobin_alpha_P69905       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLS
Bornean_orangutan_hemoglobin_a      MVLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS
Lowland_gorilla_hemoglobin_alp      -VLSPADKTNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS
Atlantic_bottle-nosed_dolphin_      -VLSPADKTNVKGTWSKIGNHSAEYGAEALERMFINFPSTKTYFSHFDLG
Minke_whale_hemoglobin_alpha_P      MVLSPTDKSNVKATWAKIGNHGAEYGAEALERMFMNFPSTKTYFPHFDLG
sheep_hemoglobin_alpha_Q28743       MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLS
bovine_hemoglobin_alpha_P01966      MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS
hippopotamus_hemoglobin_alpha_      -VLSANDKSNVKAAWGKVGNHAPEYGAEALERMFLSFPTTKTYFPHFDLS
Eastern_gray_kangaroo_hemoglob      -VLSAADKGHVKAIWGKVGGHAGEYAAEGLERTFHSFPTTKTYFPHFDLS
Nile_crocodile_hemoglobin_alph      -VLSSDDKCNVKAVWSKVAGHLEEYGAEALERMFCAYPQTKIYFPHFDLS
American_alligator_hemoglobin_      MVLSMEDKSNVKAIWGKASGHLEEYGAEALERMFCAYPQTKIYFPHFDMS
Western_painted_turtle_hemoglo      -VLNAGDKANVKAVWNKVAAHVEEYGAETLERMFTVYPQTKTYFPHFDLH
Galapagos_giant_tortoise_hemog      MVLTAGDKANVKTVWSKVGSHLEEYGSETLERLFIVYPSTKTYFPHFDLH
Domestic_duck_hemoglobin_alpha      MVLSAADKTNVKGVFSKIGGHAEEYGAETLERMFIAYPQTKTYFPHFDLS
Chicken_hemoglobin_alpha_P0199      MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHFDLS
Domestic_pigeon_hemoglobin_alp      MVLSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS
                                     **.  ** ::*  : * . :    . * *:* *  :* ** **.*:*: 

rat_hemoglobin_alpha_P01946         PGSAQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFK
mouse_hemoglobin_alpha_unrevie      HGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFK
polar_bear_hemoglobin_alpha_P6      PGSAQVKAHGKKVADALTTAAGHLDDLPGALSALSDLHAHKLRVDPVNFK
giant_panda_hemoglobin_alpha_P      PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFK
harbor_seal_hemoglobin_alpha_P      HGSAQVKAHGKKVADALTTAVAHMDDLPGALSALSDLHAHKLRVDPVNFK
chimpanzee_hemoglobin_alpha_P6      HGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
human_hemoglobin_alpha_P69905       HGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
Bornean_orangutan_hemoglobin_a      HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
Lowland_gorilla_hemoglobin_alp      HGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
Atlantic_bottle-nosed_dolphin_      HGSAQIKGHGKKVADALTKAVGHIDNLPDALSELSDLHAHKLRVDPVNFK
Minke_whale_hemoglobin_alpha_P      HDSAQVKGHGKKVADALTKAVGHMDNLLDALSDLSDLHAHKLRVDPANFK
sheep_hemoglobin_alpha_Q28743       HGSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFK
bovine_hemoglobin_alpha_P01966      HGSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFK
hippopotamus_hemoglobin_alpha_      HGSSQVKAHGKKVADALTKAVGHLDDLPGALSDLSDLHAHKLRVDPVNFK
Eastern_gray_kangaroo_hemoglob      HGSAQIQAHGKKIADALGQAVEHIDDLPGTLSKLSDLHAHKLRVDPVNFK
Nile_crocodile_hemoglobin_alph      HGSAQIRAHGKKVFAALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFK
American_alligator_hemoglobin_      HNSAQIRAHGKKVFSALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFK
Western_painted_turtle_hemoglo      HGSAQIRTHGKKVLTALGEAVNHIDDLASALSKLSDIHAQTLRVDPVNFK
Galapagos_giant_tortoise_hemog      HDSAQVRAHGRKVLSALGEAVNHIDDIPGALSKLSDLHAQTLRVDPVNFK
Domestic_duck_hemoglobin_alpha      HGSAQIKAHGKKVAAALVEAVNHVDDIAGALSKLSDLHAQKLRVDPVNFK
Chicken_hemoglobin_alpha_P0199      HGSAQIKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFK
Domestic_pigeon_hemoglobin_alp      HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFK
                                     .*:*:: ** *:  **  *. *:::: .:*. **::**:.*****.***

rat_hemoglobin_alpha_P01946         FLSHCLLVTLACHHPGDFTPAMHASLDKFLASVSTVLTSKYR
mouse_hemoglobin_alpha_unrevie      LLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
polar_bear_hemoglobin_alpha_P6      FLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKYR
giant_panda_hemoglobin_alpha_P      LLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKYR
harbor_seal_hemoglobin_alpha_P      LLSHCLLVTLACHHPADFTPAVHASLDKFFSAVSTVLTSKYR
chimpanzee_hemoglobin_alpha_P6      LLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
human_hemoglobin_alpha_P69905       LLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Bornean_orangutan_hemoglobin_a      LLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Lowland_gorilla_hemoglobin_alp      LLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY-
Atlantic_bottle-nosed_dolphin_      LLSHCLLVTLALHLPADFTPSVHASLDKFLASVSTVLTSKYR
Minke_whale_hemoglobin_alpha_P      LLSHCLLVTLALHLPAEFTPSVHASLDKFLASVSTVLTSKYR
sheep_hemoglobin_alpha_Q28743       LLSHTLLVTLACHHPNDFTPAVHASLDKFLANVSTVLTSKYR
bovine_hemoglobin_alpha_P01966      LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
hippopotamus_hemoglobin_alpha_      LLSHCLLVTLAAHHPSDFTPAAHASLDKFLANVSTVLTSKYR
Eastern_gray_kangaroo_hemoglob      LLSHCLLVTFAAHLGDAFTPEVHASLDKFLAAVSTVLTSKYR
Nile_crocodile_hemoglobin_alph      FLAQCVLVVVAIHHPGSLTPEVHASLDKFLCAVSSVLTSKYR
American_alligator_hemoglobin_      FLAHCVLVVFAIHHPSALSPEIHASLDKFLCAVSAVLTSKYR
Western_painted_turtle_hemoglo      FLNHCFLVVVAIHQPSVLTPEVHVSLDKFLSAVGTVLTSKYR
Galapagos_giant_tortoise_hemog      LLNLCFVVVVGRHHPTILTPEVHVSLDKFLSAVATALTSKYR
Domestic_duck_hemoglobin_alpha      FLGHCFLVVVAIHHPAALTPEVHASLDKFMCAVGAVLTAKYR
Chicken_hemoglobin_alpha_P0199      LLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR
Domestic_pigeon_hemoglobin_alp      LLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKYR
                                    :*   .:*... *    ::*  *.*****.  *.:.**:** 


query.dnd
(
(
(
(
rat_hemoglobin_alpha_P01946:0.11198,
mouse_hemoglobin_alpha_unrevie:0.04295)
:0.02489,
(
(
polar_bear_hemoglobin_alpha_P6:0.02160,
giant_panda_hemoglobin_alpha_P:0.00657)
:0.02034,
harbor_seal_hemoglobin_alpha_P:0.02941)
:0.04243)
:0.00646,
(
(
(
chimpanzee_hemoglobin_alpha_P6:0.00000,
human_hemoglobin_alpha_P69905:0.00000)
:0.00137,
(
Bornean_orangutan_hemoglobin_a:0.01120,
Lowland_gorilla_hemoglobin_alp:0.00309)
:0.00562)
:0.05586,
(
Atlantic_bottle-nosed_dolphin_:0.04538,
Minke_whale_hemoglobin_alpha_P:0.05391)
:0.06014)
:0.00497)
:0.00260,
(
(
sheep_hemoglobin_alpha_Q28743:0.04785,
bovine_hemoglobin_alpha_P01966:0.03666)
:0.01123,
hippopotamus_hemoglobin_alpha_:0.04581)
:0.02265,
(
(
(
(
Nile_crocodile_hemoglobin_alph:0.05079,
American_alligator_hemoglobin_:0.06977)
:0.06875,
(
Western_painted_turtle_hemoglo:0.09064,
Galapagos_giant_tortoise_hemog:0.11503)
:0.05478)
:0.01157,
(
(
Domestic_duck_hemoglobin_alpha:0.05701,
Chicken_hemoglobin_alpha_P0199:0.06976)
:0.01773,
Domestic_pigeon_hemoglobin_alp:0.09847)
:0.03220)
:0.06574,
Eastern_gray_kangaroo_hemoglob:0.10433)
:0.02835);


************** [tree] **************

options = -type=protein -tree -outputtree=dist -kimura -tossgaps

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Clustal
Sequence 1: rat_hemoglobin_alpha_P01946         142 aa
Sequence 2: mouse_hemoglobin_alpha_unrevie      142 aa
Sequence 3: polar_bear_hemoglobin_alpha_P6      142 aa
Sequence 4: giant_panda_hemoglobin_alpha_P      142 aa
Sequence 5: harbor_seal_hemoglobin_alpha_P      142 aa
Sequence 6: chimpanzee_hemoglobin_alpha_P6      142 aa
Sequence 7: human_hemoglobin_alpha_P69905       142 aa
Sequence 8: Bornean_orangutan_hemoglobin_a      142 aa
Sequence 9: Lowland_gorilla_hemoglobin_alp      142 aa
Sequence 10: Atlantic_bottle-nosed_dolphin_      142 aa
Sequence 11: Minke_whale_hemoglobin_alpha_P      142 aa
Sequence 12: sheep_hemoglobin_alpha_Q28743       142 aa
Sequence 13: bovine_hemoglobin_alpha_P01966      142 aa
Sequence 14: hippopotamus_hemoglobin_alpha_      142 aa
Sequence 15: Eastern_gray_kangaroo_hemoglob      142 aa
Sequence 16: Nile_crocodile_hemoglobin_alph      142 aa
Sequence 17: American_alligator_hemoglobin_      142 aa
Sequence 18: Western_painted_turtle_hemoglo      142 aa
Sequence 19: Galapagos_giant_tortoise_hemog      142 aa
Sequence 20: Domestic_duck_hemoglobin_alpha      142 aa
Sequence 21: Chicken_hemoglobin_alpha_P0199      142 aa
Sequence 22: Domestic_pigeon_hemoglobin_alp      142 aa


query.dst
    22
rat_hemoglobin_alpha_P01946     0.000  0.177  0.243  0.243  0.233  0.263  0.263  0.273 
           0.273  0.294  0.337  0.273  0.273  0.243  0.360  0.444 
           0.469  0.566  0.595  0.419  0.482  0.496 
mouse_hemoglobin_alpha_unrevie  0.177  0.000  0.159  0.159  0.186  0.159  0.159  0.186 
           0.168  0.214  0.205  0.168  0.150  0.150  0.283  0.407 
           0.395  0.482  0.523  0.395  0.371  0.395 
polar_bear_hemoglobin_alpha_P6  0.243  0.159  0.000  0.029  0.083  0.177  0.177  0.195 
           0.186  0.253  0.243  0.214  0.214  0.186  0.273  0.407 
           0.431  0.469  0.482  0.360  0.395  0.371 
giant_panda_hemoglobin_alpha_P  0.243  0.159  0.029  0.000  0.052  0.150  0.150  0.168 
           0.159  0.224  0.233  0.195  0.186  0.177  0.243  0.395 
           0.431  0.469  0.469  0.337  0.383  0.371 
harbor_seal_hemoglobin_alpha_P  0.233  0.186  0.083  0.052  0.000  0.150  0.150  0.168 
           0.159  0.214  0.233  0.195  0.195  0.186  0.243  0.371 
           0.407  0.444  0.456  0.315  0.360  0.360 
chimpanzee_hemoglobin_alpha_P6  0.263  0.159  0.177  0.150  0.150  0.000  0.000  0.022 
           0.007  0.186  0.195  0.159  0.133  0.141  0.224  0.407 
           0.444  0.431  0.496  0.360  0.383  0.407 
human_hemoglobin_alpha_P69905   0.263  0.159  0.177  0.150  0.150  0.000  0.000  0.022 
           0.007  0.186  0.195  0.159  0.133  0.141  0.224  0.407 
           0.444  0.431  0.496  0.360  0.383  0.407 
Bornean_orangutan_hemoglobin_a  0.273  0.186  0.195  0.168  0.168  0.022  0.022  0.000 
           0.014  0.205  0.224  0.177  0.159  0.159  0.243  0.431 
           0.469  0.456  0.496  0.371  0.407  0.419 
Lowland_gorilla_hemoglobin_alp  0.273  0.168  0.186  0.159  0.159  0.007  0.007  0.014 
           0.000  0.195  0.205  0.159  0.141  0.150  0.233  0.419 
           0.456  0.444  0.509  0.371  0.395  0.395 
Atlantic_bottle-nosed_dolphin_  0.294  0.214  0.253  0.224  0.214  0.186  0.186  0.205 
           0.195  0.000  0.108  0.253  0.205  0.224  0.304  0.419 
           0.469  0.456  0.496  0.360  0.383  0.431 
Minke_whale_hemoglobin_alpha_P  0.337  0.205  0.243  0.233  0.233  0.195  0.195  0.224 
           0.205  0.108  0.000  0.253  0.233  0.214  0.348  0.469 
           0.482  0.482  0.523  0.444  0.444  0.444 
sheep_hemoglobin_alpha_Q28743   0.273  0.168  0.214  0.195  0.195  0.159  0.159  0.177 
           0.159  0.253  0.253  0.000  0.091  0.108  0.243  0.407 
           0.444  0.482  0.509  0.395  0.371  0.395 
bovine_hemoglobin_alpha_P01966  0.273  0.150  0.214  0.186  0.195  0.133  0.133  0.159 
           0.141  0.205  0.233  0.091  0.000  0.108  0.214  0.383 
           0.419  0.431  0.482  0.371  0.371  0.395 
hippopotamus_hemoglobin_alpha_  0.243  0.150  0.186  0.177  0.186  0.141  0.141  0.159 
           0.150  0.224  0.214  0.108  0.108  0.000  0.233  0.383 
           0.383  0.431  0.469  0.383  0.407  0.395 
Eastern_gray_kangaroo_hemoglob  0.360  0.283  0.273  0.243  0.243  0.224  0.224  0.243 
           0.233  0.304  0.348  0.243  0.214  0.233  0.000  0.395 
           0.395  0.419  0.469  0.371  0.348  0.407 
Nile_crocodile_hemoglobin_alph  0.444  0.407  0.407  0.395  0.371  0.407  0.407  0.431 
           0.419  0.419  0.469  0.407  0.383  0.383  0.395  0.000 
           0.133  0.294  0.371  0.263  0.294  0.395 
American_alligator_hemoglobin_  0.469  0.395  0.431  0.431  0.407  0.444  0.444  0.469 
           0.456  0.469  0.482  0.444  0.419  0.383  0.395  0.133 
           0.000  0.360  0.444  0.315  0.360  0.431 
Western_painted_turtle_hemoglo  0.566  0.482  0.469  0.469  0.444  0.431  0.431  0.456 
           0.444  0.456  0.482  0.482  0.431  0.431  0.419  0.294 
           0.360  0.000  0.243  0.273  0.294  0.337 
Galapagos_giant_tortoise_hemog  0.595  0.523  0.482  0.469  0.456  0.496  0.496  0.496 
           0.509  0.496  0.523  0.509  0.482  0.469  0.469  0.371 
           0.444  0.243  0.000  0.337  0.383  0.395 
Domestic_duck_hemoglobin_alpha  0.419  0.395  0.360  0.337  0.315  0.360  0.360  0.371 
           0.371  0.360  0.444  0.395  0.371  0.383  0.371  0.263 
           0.315  0.273  0.337  0.000  0.141  0.195 
Chicken_hemoglobin_alpha_P0199  0.482  0.371  0.395  0.383  0.360  0.383  0.383  0.407 
           0.395  0.383  0.444  0.371  0.371  0.407  0.348  0.294 
           0.360  0.294  0.383  0.141  0.000  0.224 
Domestic_pigeon_hemoglobin_alp  0.496  0.395  0.371  0.371  0.360  0.407  0.407  0.419 
           0.395  0.431  0.444  0.395  0.395  0.395  0.407  0.395 
           0.431  0.337  0.395  0.195  0.224  0.000 

query.ph
(
(
(
(
rat_hemoglobin_alpha_P01946:0.13690,
mouse_hemoglobin_alpha_unrevie:0.03994)
:0.03520,
(
(
polar_bear_hemoglobin_alpha_P6:0.02428,
giant_panda_hemoglobin_alpha_P:0.00488)
:0.02329,
harbor_seal_hemoglobin_alpha_P:0.02962)
:0.04790)
:0.00905,
(
(
(
chimpanzee_hemoglobin_alpha_P6:0.00000,
human_hemoglobin_alpha_P69905:0.00000)
:0.00035,
(
Bornean_orangutan_hemoglobin_a:0.01365,
Lowland_gorilla_hemoglobin_alp:0.00078)
:0.00690)
:0.05983,
(
Atlantic_bottle-nosed_dolphin_:0.04671,
Minke_whale_hemoglobin_alpha_P:0.06087)
:0.07788)
:0.00762)
:0.00559,
(
(
sheep_hemoglobin_alpha_Q28743:0.05320,
bovine_hemoglobin_alpha_P01966:0.03802)
:0.01405,
hippopotamus_hemoglobin_alpha_:0.04793)
:0.02504,
(
Eastern_gray_kangaroo_hemoglob:0.11643,
(
(
(
Nile_crocodile_hemoglobin_alph:0.04918,
American_alligator_hemoglobin_:0.08364)
:0.09124,
(
Western_painted_turtle_hemoglo:0.09865,
Galapagos_giant_tortoise_hemog:0.14434)
:0.08789)
:0.02072,
(
(
Domestic_duck_hemoglobin_alpha:0.06043,
Chicken_hemoglobin_alpha_P0199:0.08099)
:0.01962,
Domestic_pigeon_hemoglobin_alp:0.11901)
:0.04315)
:0.10871)
:0.04116);