受付番号は、【20080727192203_9468】です。


************** [align] **************

options = -align -type=protein -matrix=blosum -gapdist=8 -maxdiv=40 -outorder=aligned -gapopen=10 -gapext=0.2 -pwmatrix=blosum -pwgapopen=10 -pwgapext=0.1

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Pearson
Sequence 1: human-P61626                    148 aa
Sequence 2: akagezaru-P30201                148 aa
Sequence 3: OliveBaboon-P61629              148 aa
Sequence 4: Chimpanzee-P61628               148 aa
Sequence 5: BorneanOrangutan-P79239         148 aa
Sequence 6: LowlandGorilla-P79179           148 aa
Sequence 7: JapaneseQuail-Uzura-P00701      147 aa
Sequence 8: Chicken-P00698                  147 aa
Sequence 9: DomesticDuck-P00705             147 aa
Sequence 10: Mouse-Q3TXG2                    163 aa
Sequence 11: Sheep-A4Z8Q3                    148 aa
Sequence 12: Turkey-P00703                   147 aa
Sequence 13: Rat-P00697                      148 aa
Sequence 14: Bovine-P80189                   148 aa
Sequence 15: Pig-P12069                      148 aa
Sequence 16: Hirame-Q9DD65                   143 aa
Sequence 17: Sheep-P17607                    147 aa
Sequence 18: Fugu-P61944                     143 aa
Sequence 19: Rabbit-P16973                   130 aa
Sequence 20: GraySeal-Q659U5                 148 aa
Sequence 21: RainbowTrout-P11941             144 aa
Sequence 22: Dog1-P81708                     129 aa
Sequence 23: Dog2-P81709                     130 aa
Sequence 24: camel-P37712                    130 aa
Sequence 25: SeaTurtle-P84492                130 aa
Sequence 26: pigeon-P00708                   127 aa
Sequence 27: SilkMoth-P48816                 137 aa
Sequence 28: mosquito-Q17005                 140 aa
Sequence 29: Zebrafish-Q90YS5                151 aa
Sequence 30: Carp-Q9IBG5                     145 aa
Start of Pairwise alignments
Aligning...

== Aligned score is not displayed ==

Start of Multiple Alignment
There are 29 groups
Aligning...

== Aligned score is not displayed ==

Alignment Score 244985


query.aln
CLUSTAL W (1.83) multiple sequence alignment


SilkMoth-P48816                 ---------------MQKLIIFALVVLCVGSEAKTFTRCGLVHELRK---
mosquito-Q17005                 -------------MKVFSTVLLAIVACCAVAEAKTFGKCELAKALAN---
Chicken-P00698                  ---------------MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGL
Turkey-P00703                   ---------------MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGL
JapaneseQuail-Uzura-P00701      ---------------MRSLLVLVLCFLPLAALGKVYGRCELAAAMKRHGL
DomesticDuck-P00705             ---------------MKALLTLVFCLLPLAAQGKVYSRCELAAAMKRLGL
SeaTurtle-P84492                ---------------------------------KTYERCELARAMKRLGL
human-P61626                    ---------------MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGM
Chimpanzee-P61628               ---------------MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGM
LowlandGorilla-P79179           ---------------MKALIVLGLVLLSVMVQGKVFERCELARTLKRLGM
BorneanOrangutan-P79239         ---------------MKALIILGLVLLSVTVQSKVFERCELARTLKRLGM
akagezaru-P30201                ---------------MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGL
OliveBaboon-P61629              ---------------MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGL
Sheep-A4Z8Q3                    ---------------MKALIILGLLLLSVAVQAKVFERCELARTLKRFGM
Bovine-P80189                   ---------------MKALLILGLLLFSVAVQGKVFERCELARSLKRFGM
GraySeal-Q659U5                 ---------------MKALLLLGLLLLSVTVQGKIFERCDLARTLKRLGL
Dog2-P81709                     ---------------------------------KIFERCELARTLKNLGL
Rabbit-P16973                   ---------------------------------KIYERCELARTLKKLGL
Sheep-P17607                    ---------------MKALIILGLLCLSVAVQGKVFERCELARTLKELGL
camel-P37712                    ---------------------------------KVWERCALARKLKELGM
Mouse-Q3TXG2                    MLSLVSQQLTQPPVTMKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGM
Rat-P00697                      ---------------MKALLVLGFLLLSASVQAKIYERCQFARTLKRNGM
Pig-P12069                      ---------------MKTLLVLALLLLSVSVQAKVYDRCEFARILKKSGM
Hirame-Q9DD65                   ------------------MRTLVVLLLVAVANARVYERCEWARLLRNQGM
Fugu-P61944                     ------------------MKIPVFLLLLALANAKVFQRCEWARVLKARGM
RainbowTrout-P11941             ------------------MRAVVVLLLVAVASAKVYDRCELARALKASGM
Dog1-P81708                     ---------------------------------KIFSKCELARKLKSMGM
pigeon-P00708                   ---------------------------------KDIPRCELVKILRRHGF
Zebrafish-Q90YS5                ---------------MRLAVVFLCLAWMSSCESKTLGRCDVYKIFKNEGL
Carp-Q9IBG5                     ---------------MKVTIAVLCLMWLCLCESRRLKRCDVVRIFKQEGL
                                                                 :   :*     :     

SilkMoth-P48816                 HGFEENLMRNWVCLVEHESSRDTSKTNTN-RNGSKDYGLFQINDRYWCSK
mosquito-Q17005                 NGIAKASLPDWVCLVQNESAFSTSATNKN-KNGSTDYGIFQINNKYWCDS
Chicken-P00698                  DNYRGYSLGNWVCAAKFESNFNTQATNRN-TDGSTDYGILQINSRWWCND
Turkey-P00703                   DNYRGYSLGNWVCAAKFESNFNTHATNRN-TDGSTDYGILQINSRWWCND
JapaneseQuail-Uzura-P00701      DKYQGYSLGNWVCAAKFESNFNTQATNRN-TDGSTDYGILQINSRWWCND
DomesticDuck-P00705             DNYRGYSLGNWVCAANYESGFNTQATNRN-TDGSTDYGILQINSRWWCDN
SeaTurtle-P84492                DGYWGYSLGHWVCAAKYESNFNTGATNYNPGDQSTDYGILQINSRWWCND
human-P61626                    DGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCND
Chimpanzee-P61628               DGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCND
LowlandGorilla-P79179           DGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCND
BorneanOrangutan-P79239         DGYRGISLANWMCLAKWESGYNTRATNYNPGDRSTDYGIFQINSRYWCND
akagezaru-P30201                DGYRGISLANWVCLAKWESNYNTQATNYNPGDQSTDYGIFQINSHYWCNN
OliveBaboon-P61629              DGYRGISLANWVCLAKWESDYNTQATNYNPGDQSTDYGIFQINSHYWCNN
Sheep-A4Z8Q3                    DGFRGISLANWMCLARWESSYNTQATNYNSGDRSTDYGIFQINSHWWCND
Bovine-P80189                   DNFRGISLANWMCLARWESNYNTQATNYNAGDQSTDYGIFQINSHWWCND
GraySeal-Q659U5                 AGFKGVSLANWMCLAKWESNYNTKATNYNPGSRSTDYGIFQINSRYWCND
Dog2-P81709                     AGYKGVSLANWVCLAKWESNYNTRATNYNPGSKSTDYGIFQINSRYWCND
Rabbit-P16973                   DGYKGVSLANWMCLAKWESSYNTRATNYNPGDKSTDYGIFQINSRYWCND
Sheep-P17607                    DGYKGVSLANWLCLTKWESSYNTKATNYNPGSESTDYGIFQINSKWWCND
camel-P37712                    DGYRGVSLANWMCLTKWESDYNTDATNYNPSSESTDYGIFQINSRYWCNN
Mouse-Q3TXG2                    AGYYGVSLADWVCLAQHESNYNTRATNYNRGDQSTDYGIFQINSRYWCND
Rat-P00697                      SGYYGVSLADWVCLAQHESNYNTQARNYNPGDQSTDYGIFQINSRYWCND
Pig-P12069                      DGYRGVSLANWVCLAKWESNFNTKATNYNPGSQSTDYGIFQINSRYWCND
Hirame-Q9DD65                   DGYRGISLANWVCLTEWESHYNTRATNHN-TDGSTDYGIFQINSRWWCND
Fugu-P61944                     DGYRGISLADWVCLSKWESQYNTNAINHN-TDGSTDYGIFQINSRWWCND
RainbowTrout-P11941             DGYAGNSLPNWVCLSKWESSYNTQATNRN-TDGSTDYGIFQINSRYWCDD
Dog1-P81708                     DGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLNSKWWCKS
pigeon-P00708                   EGFVGKTVANWVCLVKHESGYRTTAFNNN-GPNSRDYGIFQINSKYWCND
Zebrafish-Q90YS5                DGFEGFSIGNYVCTAYWESRFKTHRVRSA--DTGKDYGIFQINSFKWCDD
Carp-Q9IBG5                     DGFEGFSVGNYVCTAYWESRFKTHRVRSA--DTGKDYGIFQINSFKWCDD
                                       : .::*    **   *   .      . ***::*:*.  **..

SilkMoth-P48816                 GASP--GKDCNVKCSDLLTDDITKAAKCAKKIYKR-HRFDAWYGWKNHCQ
mosquito-Q17005                 GYG---SNDCKIACKNLLNDDITDDIKCAKLIHKR-HGFNAWYGWKNHCN
Chicken-P00698                  GRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCK
Turkey-P00703                   GRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCK
JapaneseQuail-Uzura-P00701      GRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDVHGMNAWVAWRNRCK
DomesticDuck-P00705             GKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCR
SeaTurtle-P84492                GKTPRTKNACKIQCRELLTADITASVNCAKRVVRDPNGMGAWVAWTKNCK
human-P61626                    GKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQ
Chimpanzee-P61628               GKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQ
LowlandGorilla-P79179           GKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQ
BorneanOrangutan-P79239         GKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQ
akagezaru-P30201                GKTPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHCQ
OliveBaboon-P61629              GKTPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHCQ
Sheep-A4Z8Q3                    GKTPGAVNACHIPCSALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQ
Bovine-P80189                   GKTPGAVNACHLPCGALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQ
GraySeal-Q659U5                 GKTPRAVNACHIPCSDLLKDDITQAVACAKRVVSDPNGIRAWVAWRAHCE
Dog2-P81709                     GKTPRAVNACHISCSALLQDDITQAVACAKRVVSDPNGIRAWVAWRAHCE
Rabbit-P16973                   GKTPRAVNACHIPCSDLLKDDITQAVACAKRVVSDPQGIRAWVAWRNHCQ
Sheep-P17607                    GKTPNAVDGCHVSCSELMENNIAKAVACAKHIVSE-QGITAWVAWKSHCR
camel-P37712                    GKTPHAVNGCGINCNVLLEDDITKAVQCAKRVVRDPQGVRAWVAWKNHCE
Mouse-Q3TXG2                    GKTPRAVNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQ
Rat-P00697                      GKTPRAKNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCK
Pig-P12069                      GKTPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPQGIKAWVAWKAHCQ
Hirame-Q9DD65                   SQTP-TSNACNIRCSELLTDDVIVAIKCAKRVVRDPNGIGAWVAWRQHCQ
Fugu-P61944                     DRIP-TRNACNIKCSALQTDDVTVAINCAKRVVSDPQGIRAWVAWNRHCQ
RainbowTrout-P11941             GRTPGAKNVCGIRCSQLLTADLTVAIRCAKRVVLDPNGIGAWVAWRLHCQ
Dog1-P81708                     NSHS-SANACNIMCSKFLDDNIDDDIACAKRVVKDPNGMSAWVAWVKHCK
pigeon-P00708                   GKTRGSKNACNINCSKLRDDNIADDIQCAKKIAREARGLTPWVAWKKYCQ
Zebrafish-Q90YS5                G-TPGGKNLCKVACSDLLNDDLKASVGCAKLIVKM-DGLKSWETWDSYCN
Carp-Q9IBG5                     G-TPGGKNKCKIPCSDLLKDDLKASVECAKLIVKT-EGLKSWDTWGSYCK
                                .      . * : *  :   ::     *** :      . .*  *   *.

SilkMoth-P48816                 G-SLPDISSC----------
mosquito-Q17005                 GKKLPNVSSCF---------
Chicken-P00698                  GTDVQAWIRGCRL-------
Turkey-P00703                   GTDVHAWIRGCRL-------
JapaneseQuail-Uzura-P00701      GTDVNAWIRGCRL-------
DomesticDuck-P00705             GTDVSKWIRGCRL-------
SeaTurtle-P84492                GRDVSPWIRDCGL-------
human-P61626                    NRDVRQYVQGCGV-------
Chimpanzee-P61628               NRDVRQYVQGCGV-------
LowlandGorilla-P79179           NRDVRQYVQGCGV-------
BorneanOrangutan-P79239         NRDVRQYVQGCGV-------
akagezaru-P30201                NRDVSQYVQGCGV-------
OliveBaboon-P61629              NRDVSQYVQGCGV-------
Sheep-A4Z8Q3                    NQDLTSYIQGCGV-------
Bovine-P80189                   NQDLTSYIQGCGV-------
GraySeal-Q659U5                 NQDVSQYVRNCGV-------
Dog2-P81709                     NRDVSQYVRNCGV-------
Rabbit-P16973                   NQDLTPYIRGCGV-------
Sheep-P17607                    DHDVSSYVEGCSL-------
camel-P37712                    GHDVEQYVEGCDL-------
Mouse-Q3TXG2                    NRDLSQYIRNCGV-------
Rat-P00697                      NRDLSGYIRNCGV-------
Pig-P12069                      NKDVSQYIRGCKL-------
Hirame-Q9DD65                   GQDLSSYLAGCGL-------
Fugu-P61944                     NRDLSAYIAGCGL-------
RainbowTrout-P11941             NQDLRSYVAGCGV-------
Dog1-P81708                     GKDLSKYLASCNL-------
pigeon-P00708                   GKDLSSYVRGC---------
Zebrafish-Q90YS5                GRKMSRWVKGCEQRKQSLRA
Carp-Q9IBG5                     GRKMSRWVKGCEEH------
                                . .:                


query.dnd
(
(
(
(
(
(
(
(
(
human-P61626:0.00000,
Chimpanzee-P61628:0.00000)
:0.00247,
LowlandGorilla-P79179:0.00429)
:0.01038,
BorneanOrangutan-P79239:0.00989)
:0.04518,
(
akagezaru-P30201:0.00224,
OliveBaboon-P61629:0.00452)
:0.05279)
:0.03128,
(
Sheep-A4Z8Q3:0.02287,
Bovine-P80189:0.04470)
:0.06331)
:0.01838,
(
Rabbit-P16973:0.06194,
(
GraySeal-Q659U5:0.04772,
Dog2-P81709:0.02920)
:0.03421)
:0.01586)
:0.01065,
(
Sheep-P17607:0.15835,
camel-P37712:0.12627)
:0.03888)
:0.01560,
(
(
(
(
(
JapaneseQuail-Uzura-P00701:0.03183,
(
Chicken-P00698:0.01800,
Turkey-P00703:0.02962)
:0.00559)
:0.08127,
DomesticDuck-P00705:0.09220)
:0.06825,
SeaTurtle-P84492:0.12105)
:0.05772,
(
Dog1-P81708:0.24156,
(
pigeon-P00708:0.22348,
(
(
SilkMoth-P48816:0.24679,
mosquito-Q17005:0.23497)
:0.07957,
(
Zebrafish-Q90YS5:0.10492,
Carp-Q9IBG5:0.09508)
:0.23314)
:0.02847)
:0.01937)
:0.03621)
:0.01331,
(
(
Hirame-Q9DD65:0.12820,
Fugu-P61944:0.13055)
:0.01626,
RainbowTrout-P11941:0.13758)
:0.04937)
:0.03397)
:0.01137,
(
Mouse-Q3TXG2:0.04964,
Rat-P00697:0.07874)
:0.06192,
Pig-P12069:0.12727);


************** [tree] **************

options = -type=protein -tree -outputtree=dist -kimura -tossgaps

 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Clustal
Sequence 1: SilkMoth-P48816                 170 aa
Sequence 2: mosquito-Q17005                 170 aa
Sequence 3: Chicken-P00698                  170 aa
Sequence 4: Turkey-P00703                   170 aa
Sequence 5: JapaneseQuail-Uzura-P00701      170 aa
Sequence 6: DomesticDuck-P00705             170 aa
Sequence 7: SeaTurtle-P84492                170 aa
Sequence 8: human-P61626                    170 aa
Sequence 9: Chimpanzee-P61628               170 aa
Sequence 10: LowlandGorilla-P79179           170 aa
Sequence 11: BorneanOrangutan-P79239         170 aa
Sequence 12: akagezaru-P30201                170 aa
Sequence 13: OliveBaboon-P61629              170 aa
Sequence 14: Sheep-A4Z8Q3                    170 aa
Sequence 15: Bovine-P80189                   170 aa
Sequence 16: GraySeal-Q659U5                 170 aa
Sequence 17: Dog2-P81709                     170 aa
Sequence 18: Rabbit-P16973                   170 aa
Sequence 19: Sheep-P17607                    170 aa
Sequence 20: camel-P37712                    170 aa
Sequence 21: Mouse-Q3TXG2                    170 aa
Sequence 22: Rat-P00697                      170 aa
Sequence 23: Pig-P12069                      170 aa
Sequence 24: Hirame-Q9DD65                   170 aa
Sequence 25: Fugu-P61944                     170 aa
Sequence 26: RainbowTrout-P11941             170 aa
Sequence 27: Dog1-P81708                     170 aa
Sequence 28: pigeon-P00708                   170 aa
Sequence 29: Zebrafish-Q90YS5                170 aa
Sequence 30: Carp-Q9IBG5                     170 aa


query.dst
    30
SilkMoth-P48816             0.000  0.631  1.095  1.128  1.095  1.162  1.271  1.095 
           1.095  1.095  1.095  1.095  1.095  1.004  1.095  1.004 
           1.034  0.922  1.095  1.004  1.034  1.095  1.128  0.976 
           1.064  0.948  1.162  0.948  1.271  1.351 
mosquito-Q17005             0.631  0.000  0.870  0.896  0.870  0.896  0.948  0.976 
           0.976  0.976  0.976  0.896  0.896  0.922  0.976  0.948 
           0.870  0.896  1.034  0.896  0.846  0.896  0.870  0.896 
           0.948  0.799  0.846  0.922  1.034  1.271 
Chicken-P00698              1.095  0.870  0.000  0.054  0.044  0.196  0.304  0.491 
           0.491  0.491  0.491  0.491  0.508  0.460  0.460  0.524 
           0.491  0.491  0.651  0.594  0.541  0.576  0.559  0.594 
           0.524  0.524  0.690  0.846  0.896  0.896 
Turkey-P00703               1.128  0.896  0.054  0.000  0.072  0.208  0.304  0.541 
           0.541  0.541  0.541  0.559  0.576  0.524  0.524  0.576 
           0.541  0.508  0.690  0.631  0.559  0.594  0.576  0.613 
           0.594  0.541  0.776  0.799  0.870  0.870 
JapaneseQuail-Uzura-P00701  1.095  0.870  0.044  0.072  0.000  0.208  0.304  0.524 
           0.524  0.524  0.524  0.524  0.541  0.491  0.508  0.559 
           0.524  0.476  0.670  0.613  0.524  0.559  0.559  0.613 
           0.559  0.524  0.732  0.846  0.896  0.896 
DomesticDuck-P00705         1.162  0.896  0.196  0.208  0.208  0.000  0.344  0.508 
           0.508  0.508  0.508  0.491  0.491  0.476  0.491  0.559 
           0.541  0.476  0.670  0.541  0.524  0.541  0.541  0.576 
           0.613  0.460  0.670  0.870  0.922  0.922 
SeaTurtle-P84492            1.271  0.948  0.304  0.304  0.304  0.344  0.000  0.524 
           0.524  0.524  0.524  0.491  0.508  0.524  0.524  0.491 
           0.460  0.460  0.670  0.559  0.429  0.444  0.460  0.524 
           0.594  0.508  0.651  0.846  0.922  0.896 
human-P61626                1.095  0.976  0.491  0.541  0.524  0.508  0.524  0.000 
           0.000  0.000  0.000  0.122  0.122  0.174  0.208  0.243 
           0.208  0.208  0.344  0.304  0.267  0.371  0.317  0.400 
           0.400  0.400  0.690  0.631  1.064  1.064 
Chimpanzee-P61628           1.095  0.976  0.491  0.541  0.524  0.508  0.524  0.000 
           0.000  0.000  0.000  0.122  0.122  0.174  0.208  0.243 
           0.208  0.208  0.344  0.304  0.267  0.371  0.317  0.400 
           0.400  0.400  0.690  0.631  1.064  1.064 
LowlandGorilla-P79179       1.095  0.976  0.491  0.541  0.524  0.508  0.524  0.000 
           0.000  0.000  0.000  0.122  0.122  0.174  0.208  0.243 
           0.208  0.208  0.344  0.304  0.267  0.371  0.317  0.400 
           0.400  0.400  0.690  0.631  1.064  1.064 
BorneanOrangutan-P79239     1.095  0.976  0.491  0.541  0.524  0.508  0.524  0.000 
           0.000  0.000  0.000  0.122  0.122  0.174  0.208  0.243 
           0.208  0.208  0.344  0.304  0.267  0.371  0.317  0.400 
           0.400  0.400  0.690  0.631  1.064  1.064 
akagezaru-P30201            1.095  0.896  0.491  0.559  0.524  0.491  0.491  0.122 
           0.122  0.122  0.122  0.000  0.009  0.185  0.196  0.243 
           0.185  0.231  0.358  0.304  0.267  0.317  0.292  0.429 
           0.386  0.414  0.594  0.651  1.064  1.034 
OliveBaboon-P61629          1.095  0.896  0.508  0.576  0.541  0.491  0.508  0.122 
           0.122  0.122  0.122  0.009  0.000  0.185  0.208  0.255 
           0.196  0.231  0.358  0.292  0.279  0.331  0.304  0.429 
           0.386  0.414  0.613  0.651  1.064  1.034 
Sheep-A4Z8Q3                1.004  0.922  0.460  0.524  0.491  0.476  0.524  0.174 
           0.174  0.174  0.174  0.185  0.185  0.000  0.054  0.219 
           0.243  0.153  0.358  0.371  0.267  0.304  0.358  0.371 
           0.331  0.371  0.613  0.711  1.004  0.948 
Bovine-P80189               1.095  0.976  0.460  0.524  0.508  0.491  0.524  0.208 
           0.208  0.208  0.208  0.196  0.208  0.054  0.000  0.267 
           0.279  0.208  0.414  0.400  0.292  0.331  0.358  0.414 
           0.371  0.429  0.651  0.776  1.064  1.034 
GraySeal-Q659U5             1.004  0.948  0.524  0.576  0.559  0.559  0.491  0.243 
           0.243  0.243  0.243  0.243  0.255  0.219  0.267  0.000 
           0.082  0.164  0.371  0.317  0.255  0.292  0.304  0.491 
           0.476  0.444  0.631  0.711  1.004  0.922 
Dog2-P81709                 1.034  0.870  0.491  0.541  0.524  0.541  0.460  0.208 
           0.208  0.208  0.208  0.185  0.196  0.243  0.279  0.082 
           0.000  0.164  0.344  0.317  0.196  0.267  0.267  0.414 
           0.414  0.400  0.613  0.711  1.034  1.034 
Rabbit-P16973               0.922  0.896  0.491  0.508  0.476  0.476  0.460  0.208 
           0.208  0.208  0.208  0.231  0.231  0.153  0.208  0.164 
           0.164  0.000  0.371  0.317  0.231  0.267  0.279  0.386 
           0.371  0.344  0.670  0.711  1.034  0.948 
Sheep-P17607                1.095  1.034  0.651  0.690  0.670  0.670  0.670  0.344 
           0.344  0.344  0.344  0.358  0.358  0.358  0.414  0.371 
           0.344  0.371  0.000  0.344  0.524  0.594  0.444  0.541 
           0.559  0.541  0.799  0.670  1.095  1.128 
camel-P37712                1.004  0.896  0.594  0.631  0.613  0.541  0.559  0.304 
           0.304  0.304  0.304  0.304  0.292  0.371  0.400  0.317 
           0.317  0.317  0.344  0.000  0.358  0.429  0.344  0.476 
           0.508  0.460  0.776  0.732  1.128  1.095 
Mouse-Q3TXG2                1.034  0.846  0.541  0.559  0.524  0.524  0.429  0.267 
           0.267  0.267  0.267  0.267  0.279  0.267  0.292  0.255 
           0.196  0.231  0.524  0.358  0.000  0.112  0.255  0.371 
           0.358  0.386  0.690  0.631  1.128  1.095 
Rat-P00697                  1.095  0.896  0.576  0.594  0.559  0.541  0.444  0.371 
           0.371  0.371  0.371  0.317  0.331  0.304  0.331  0.292 
           0.267  0.267  0.594  0.429  0.112  0.000  0.331  0.460 
           0.386  0.429  0.651  0.670  1.128  1.034 
Pig-P12069                  1.128  0.870  0.559  0.576  0.559  0.541  0.460  0.317 
           0.317  0.317  0.317  0.292  0.304  0.358  0.358  0.304 
           0.267  0.279  0.444  0.344  0.255  0.331  0.000  0.414 
           0.414  0.400  0.651  0.651  0.976  0.922 
Hirame-Q9DD65               0.976  0.896  0.594  0.613  0.613  0.576  0.524  0.400 
           0.400  0.400  0.400  0.429  0.429  0.371  0.414  0.491 
           0.414  0.386  0.541  0.476  0.371  0.460  0.414  0.000 
           0.292  0.317  0.594  0.690  1.095  1.034 
Fugu-P61944                 1.064  0.948  0.524  0.594  0.559  0.613  0.594  0.400 
           0.400  0.400  0.400  0.386  0.386  0.331  0.371  0.476 
           0.414  0.371  0.559  0.508  0.358  0.386  0.414  0.292 
           0.000  0.358  0.651  0.776  1.196  1.162 
RainbowTrout-P11941         0.948  0.799  0.524  0.541  0.524  0.460  0.508  0.400 
           0.400  0.400  0.400  0.414  0.414  0.371  0.429  0.444 
           0.400  0.344  0.541  0.460  0.386  0.429  0.400  0.317 
           0.358  0.000  0.690  0.732  1.004  0.976 
Dog1-P81708                 1.162  0.846  0.690  0.776  0.732  0.670  0.651  0.690 
           0.690  0.690  0.690  0.594  0.613  0.613  0.651  0.631 
           0.613  0.670  0.799  0.776  0.690  0.651  0.651  0.594 
           0.651  0.690  0.000  0.732  1.233  1.162 
pigeon-P00708               0.948  0.922  0.846  0.799  0.846  0.870  0.846  0.631 
           0.631  0.631  0.631  0.651  0.651  0.711  0.776  0.711 
           0.711  0.711  0.670  0.732  0.631  0.670  0.651  0.690 
           0.776  0.732  0.732  0.000  1.034  1.004 
Zebrafish-Q90YS5            1.271  1.034  0.896  0.870  0.896  0.922  0.922  1.064 
           1.064  1.064  1.064  1.064  1.064  1.004  1.064  1.004 
           1.034  1.034  1.095  1.128  1.128  1.128  0.976  1.095 
           1.196  1.004  1.233  1.034  0.000  0.164 
Carp-Q9IBG5                 1.351  1.271  0.896  0.870  0.896  0.922  0.896  1.064 
           1.064  1.064  1.064  1.034  1.034  0.948  1.034  0.922 
           1.034  0.948  1.128  1.095  1.095  1.034  0.922  1.034 
           1.162  0.976  1.162  1.004  0.164  0.000 

query.ph
(
(
(
(
(
(
(
(
(
SilkMoth-P48816:0.39461,
mosquito-Q17005:0.23686)
:0.27380,
(
Zebrafish-Q90YS5:0.08945,
Carp-Q9IBG5:0.07407)
:0.56015)
:0.03587,
pigeon-P00708:0.32537)
:0.06380,
Dog1-P81708:0.36396)
:0.05789,
(
(
(
(
Chicken-P00698:0.00956,
Turkey-P00703:0.04411)
:0.00234,
JapaneseQuail-Uzura-P00701:0.02929)
:0.07833,
DomesticDuck-P00705:0.09736)
:0.06986,
SeaTurtle-P84492:0.15193)
:0.11792)
:0.03924,
(
(
Hirame-Q9DD65:0.14729,
Fugu-P61944:0.14444)
:0.02663,
RainbowTrout-P11941:0.16505)
:0.04207)
:0.03952,
(
(
Mouse-Q3TXG2:0.02601,
Rat-P00697:0.08558)
:0.08936,
Pig-P12069:0.14748)
:0.00250)
:0.03292,
(
(
GraySeal-Q659U5:0.05485,
Dog2-P81709:0.02722)
:0.04981,
Rabbit-P16973:0.07268)
:0.01604)
:0.00399,
(
(
(
(
(
human-P61626:0.00000,
Chimpanzee-P61628:0.00000)
:0.00000,
LowlandGorilla-P79179:0.00000)
:0.00000,
BorneanOrangutan-P79239:0.00000)
:0.06265,
(
akagezaru-P30201:0.00247,
OliveBaboon-P61629:0.00621)
:0.05471)
:0.02856,
(
Sheep-A4Z8Q3:0.01028,
Bovine-P80189:0.04339)
:0.07613)
:0.02325,
(
Sheep-P17607:0.20118,
camel-P37712:0.14284)
:0.06452);