受付番号は、【20080705161611_17090】です。


[CLUSTALW SETUP (Graphical View(<= 100 sequences) | Text View(any number of sequences))]
BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= query
         (154 letters)

Database: PROTEIN: UniProt/Swiss-Prot + TREMBL + PDBSH + PRF protein
sequence database [Last update Jul/05/2008] 
           7,347,543 sequences; 2,386,632,819 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9QZ76|MYG_RAT Myoglobin.                                           313  3e-84
prf|2502248A|myoglobin                                                 306  4e-82
prf|1211247A|myoglobin                                                 296  4e-79
tr|Q3UVB1|Q3UVB1_MOUSE Adult male bone cDNA, RIKEN full-length e...    296  4e-79
sp|P04247|MYG_MOUSE Myoglobin.                                         296  4e-79
prf|1111223B|myoglobin                                                 293  2e-78
sp|P04248|MYG_SPAEH Myoglobin.                                         282  4e-75
tr|A9JIH7|A9JIH7_SPACA Myoglobin.                                      280  2e-74
sp|P04249|MYG_PROGU Myoglobin.                                         277  2e-73
sp|P02171|MYG_OCHPR Myoglobin.                                         275  7e-73
prf|1111223A|myoglobin                                                 275  1e-72
sp|P02164|MYG_ORYAF Myoglobin.                                         274  1e-72
sp|P02156|MYG_ERIEU Myoglobin.                                         274  1e-72
sp|P04250|MYG_LAGMA Myoglobin.                                         274  2e-72
sp|P02163|MYG_ROUAE Myoglobin.                                         273  2e-72
sp|P20856|MYG_CTEGU Myoglobin.                                         273  3e-72
sp|P02165|MYG_TUPGL Myoglobin.                                         273  3e-72
prf|0804338A|myoglobin                                                 273  3e-72
prf|1203274A|myoglobin                                                 273  4e-72
sp|P02189|MYG_PIG Myoglobin.                                           273  4e-72
prf|0912209A|myoglobin                                                 272  5e-72
sp|P02168|MYG_GALCR Myoglobin.                                         272  5e-72
prf|751773A|myoglobin                                                  272  7e-72
sp|P02167|MYG_NYCCO Myoglobin.                                         271  7e-72
sp|P11343|MYG_LUTLU Myoglobin.                                         271  8e-72
sp|P02166|MYG_PERPO Myoglobin.                                         271  9e-72
prf|771739A|myoglobin                                                  271  9e-72
prf|1703248C|myoglobin                                                 271  1e-71
prf|742502A|myoglobin                                                  271  2e-71
sp|Q6PL31|MYG_OCHCU Myoglobin.                                         270  2e-71
prf|762534A|myoglobin                                                  270  2e-71
pdb|1PMB_B|2.5 | 2| 153|N|MYOGLOBIN (AQUOMET, $P*H 7.1)         ...    270  2e-71
pdb|1PMB_A|2.5 | 2| 153|N|MYOGLOBIN (AQUOMET, $P*H 7.1)         ...    270  2e-71
pdb|1MYG_B|1.75| 2| 153|N|MYOGLOBIN (AQUOMET, PH 7.1)           ...    270  2e-71
pdb|1MYG_A|1.75| 2| 153|N|MYOGLOBIN (AQUOMET, PH 7.1)           ...    270  2e-71
pdb|1MWD_B|1.80| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    270  2e-71
pdb|1MWD_A|1.80| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    270  2e-71
pdb|1MWC_B|1.70| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    270  2e-71
pdb|1MWC_A|1.70| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    270  2e-71
pdb|1MYH_B|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    270  3e-71
pdb|1MYH_A|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    270  3e-71
prf|732176B|myoglobin                                                  270  3e-71
pdb|1YCB_B|2.1 | 2| 153|M|MYOGLOBIN (DEOXY, PH 7.1) MUTANT WITH ...    269  5e-71
pdb|1YCB_A|2.1 | 2| 153|M|MYOGLOBIN (DEOXY, PH 7.1) MUTANT WITH ...    269  5e-71
pdb|1YCA_B|2.2 | 2| 153|M|MYOGLOBIN (CARBONMONOXY, PH 7.1) MUTAN...    269  5e-71
pdb|1YCA_A|2.2 | 2| 153|M|MYOGLOBIN (CARBONMONOXY, PH 7.1) MUTAN...    269  5e-71
pdb|1MYJ_B|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    269  5e-71
pdb|1MYJ_A|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    269  5e-71
prf|1309328A|myoglobin                                                 269  6e-71
pdb|1MYI_B|2.0 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    269  6e-71
pdb|1MYI_A|2.0 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    269  6e-71
sp|P02170|MYG_RABIT Myoglobin.                                         268  7e-71
sp|P02153|MYG_CEBAP Myoglobin.                                         268  1e-70
pdb|1MNO_B|1.95| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1MNO_A|1.95| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1MDN_B|1.98| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1MDN_A|1.98| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1M6M_B|1.80| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1M6M_A|1.80| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1M6C_B|1.90| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
pdb|1M6C_A|1.90| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    268  1e-70
sp|P02154|MYG_LAGLA Myoglobin.                                         267  2e-70
sp|P02150|MYG_MACFA Myoglobin.                                         267  2e-70
sp|P68085|MYG_SEMEN Myoglobin.                                         267  2e-70
sp|P68084|MYG_PAPAN Myoglobin.                                         267  2e-70
sp|P68086|MYG_ERYPA Myoglobin.                                         267  2e-70
sp|P02147|MYG_GORBE Myoglobin.                                         266  2e-70
sp|P02155|MYG_SAISC Myoglobin.                                         266  3e-70
prf|762533A|myoglobin                                                  266  4e-70
sp|P02144|MYG_HUMAN Myoglobin.                                         266  4e-70
sp|P02152|MYG_CALJA Myoglobin.                                         266  5e-70
sp|P02151|MYG_AOTTR Myoglobin.                                         266  5e-70
prf|0611199A|myoglobin                                                 265  5e-70
pdb|1MNJ_B|2.2 | 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HI...    265  5e-70
pdb|1MNJ_A|2.2 | 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HI...    265  5e-70
sp|P02145|MYG_PANTR Myoglobin.                                         265  7e-70
prf|721939B|myoglobin                                                  265  8e-70
prf|0611199B|myoglobin                                                 265  8e-70
prf|721939A|myoglobin                                                  265  9e-70
prf|732175C|myoglobin                                                  265  1e-69
pdb|1MNK_B|2.2 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    265  1e-69
pdb|1MNK_A|2.2 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WIT...    265  1e-69
prf|1105247A|myoglobin                                                 265  1e-69
prf|1010194A|myoglobin                                                 265  1e-69
prf|754928A|myoglobin                                                  264  1e-69
prf|732175B|myoglobin                                                  264  1e-69
sp|P02148|MYG_PONPY Myoglobin.                                         264  1e-69
pdb|1MNH  |2.3 | 1| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HI...    264  2e-69
sp|P62735|MYG_HYLSY Myoglobin.                                         264  2e-69
sp|P62734|MYG_HYLAG Myoglobin.                                         264  2e-69
sp|P02181|MYG_INIGE Myoglobin.                                         263  2e-69
prf|732175A|myoglobin                                                  263  2e-69
pdb|2MM1  |2.8 | 1| 153|M|MYOGLOBIN MUTANT WITH LYS 45 REPLACED ...    263  2e-69
prf|1002206A|myoglobin                                                 263  2e-69
sp|P02160|MYG_VULCH Myoglobin.                                         263  3e-69
pdb|1MNI_B|2.07| 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HI...    263  3e-69
pdb|1MNI_A|2.07| 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HI...    263  3e-69
sp|P68082|MYG_HORSE Myoglobin.                                         263  3e-69
sp|P68083|MYG_EQUBU Myoglobin.                                         263  3e-69
sp|P02159|MYG_LYCPI Myoglobin.                                         263  3e-69
sp|P14396|MYG_CASFI Myoglobin.                                         263  3e-69
prf|721919A|myoglobin                                                  263  3e-69
sp|P63114|MYG_OTOME Myoglobin.                                         263  3e-69
sp|P63113|MYG_CANFA Myoglobin.                                         263  3e-69
sp|P32428|MYG_ONDZI Myoglobin.                                         262  5e-69
sp|P02161|MYG_ZALCA Myoglobin.                                         262  5e-69
prf|711658B|myoglobin                                                  262  5e-69
prf|761377A|myoglobin                                                  261  8e-69
prf|765946A|myoglobin                                                  261  9e-69
prf|753669A|myoglobin                                                  261  1e-68
sp|P02157|MYG_MELME Myoglobin.                                         261  1e-68
prf|765945A|myoglobin                                                  261  1e-68
prf|765948A|myoglobin                                                  261  1e-68
prf|754927A|myoglobin                                                  261  1e-68
pdb|2V1K_A|1.25| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1J_A|1.4 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1I_A|1.2 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1H_A|1.3 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1G_A|1.35| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1F_A|1.2 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2V1E_A|1.3 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2IN4_A|2.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2FRK_X|1.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2FRJ_X|1.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2FRI_X|1.60| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|2FRF_A|1.20| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1YMC  |2.0 | 1| 153|N|CYANOMET-SULFMYOGLOBIN (HORSE HEART)  ...    261  1e-68
pdb|1YMB  |1.9 | 1| 153|N|METMYOGLOBIN (HORSE HEART)            ...    261  1e-68
pdb|1WLA  |1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1NPG_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1NPF_A|1.90| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1GJN_A|1.35| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1DWT_A|1.4 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1DWS_A|1.45| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1DWR_A|1.45| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
pdb|1AZI  |2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    261  1e-68
sp|Q0KIY3|MYG_PENEL Myoglobin.                                         260  2e-68
prf|0606155A|myoglobin                                                 260  2e-68
prf|711658A|myoglobin                                                  260  2e-68
sp|P68279|MYG_TURTR Myoglobin.                                         260  2e-68
sp|P68276|MYG_DELDE Myoglobin.                                         260  2e-68
sp|Q0KIY7|MYG1_STEAT Myoglobin-1.                                      260  2e-68
sp|P02174|MYG_GLOME Myoglobin.                                         260  2e-68
prf|742512A|myoglobin                                                  260  3e-68
sp|P02173|MYG_ORCOR Myoglobin.                                         260  3e-68
prf|1606205A|myoglobin                                                 259  3e-68
prf|690934A|myoglobin                                                  259  4e-68
pdb|1NZ2_A|1.90| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    259  4e-68
sp|P02193|MYG_DIDMA Myoglobin.                                         259  6e-68
pdb|1RSE  |1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: HORSE HEART MYOGL...    259  6e-68
sp|P68080|MYG_PHOVI Myoglobin.                                         258  7e-68
sp|P68081|MYG_HALGR Myoglobin.                                         258  7e-68
prf|742501A|myoglobin                                                  258  7e-68
pdb|1YMA  |2.0 | 1| 153|M|MYOGLOBIN (HORSE HEART) MUTANT WITH HI...    258  7e-68
pdb|1HRM  |1.70| 1| 153|M|MYOGLOBIN MUTANT WITH HIS 93 REPLACED ...    258  7e-68
prf|763607A|myoglobin                                                  258  8e-68
prf|0407215A|myoglobin                                                 258  1e-67
pdb|1XCH  |1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    258  1e-67
pdb|1NZ5_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    258  1e-67
pdb|1NZ4_A|1.80| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    258  1e-67
pdb|1NZ3_A|1.60| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    258  1e-67
sp|P68278|MYG_PHOPH Myoglobin.                                         258  1e-67
sp|P68277|MYG_PHODA Myoglobin.                                         258  1e-67
sp|P02169|MYG_LEPMU Myoglobin.                                         257  1e-67
sp|Q0KIY6|MYG2_STEAT Myoglobin-2.                                      257  2e-67
pdb|1HSY  |1.90| 1| 153|M|MYOGLOBIN MUTANT WITH HIS 64 REPLACED ...    257  2e-67
pdb|1BJE  |1.80| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    257  2e-67
sp|P02184|MYG_KOGSI Myoglobin.                                         257  2e-67
sp|Q0KIY5|MYG_KOGBR Myoglobin.                                         257  2e-67
pdb|2JHO_A|1.4 | 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    257  2e-67
pdb|2EB9_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    257  2e-67
pdb|2EB8_A|1.65| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    257  2e-67
pdb|1UFP_A|2.10| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    257  2e-67
sp|P02185|MYG_PHYCA Myoglobin.                                         257  2e-67
prf|770891A|myoglobin                                                  257  2e-67
sp|P02196|MYG_ORNAN Myoglobin.                                         256  3e-67
prf|754369A|myoglobin                                                  256  3e-67
prf|770872A|myoglobin                                                  256  4e-67
sp|P02177|MYG_ESCGI Myoglobin.                                         256  4e-67
sp|Q0KIY2|MYG_BALED Myoglobin.                                         256  4e-67
sp|Q0KIY1|MYG_BALBO Myoglobin.                                         256  4e-67
pdb|5MBN  |2.0 | 1| 153|N|MYOGLOBIN (DEOXY)                     ...    256  4e-67
pdb|4MBN  |2.0 | 1| 153|N|MYOGLOBIN (MET)                       ...    256  4e-67
pdb|2MYE  |1.68| 1| 153|N|MYOGLOBIN (ETHYL ISOCYANIDE, PH <<7.0)...    256  4e-67
pdb|2MYD  |1.8 | 1| 153|N|MYOGLOBIN (N-PROPYL ISOCYANIDE, PH 7.0...    256  4e-67
pdb|2MYC  |1.8 | 1| 153|N|MYOGLOBIN (N-BUTYL ISOCYANIDE, PH 7.0)...    256  4e-67
pdb|2MYB  |1.9 | 1| 153|N|MYOGLOBIN (METHYL ISOCYANIDE, PH 7.0) ...    256  4e-67
pdb|2MYA  |2.0 | 1| 153|N|MYOGLOBIN (ETHYL ISOCYANIDE, PH 7.0)  ...    256  4e-67
pdb|2MB5  |1.8 | 1| 153|N|MYOGLOBIN (CARBONMONOXYMYOGLOBIN) (NEU...    256  4e-67
pdb|2D6C_B|2.26| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|2D6C_A|2.26| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|2CMM  |1.8 | 1| 153|N|MYOGLOBIN (CYANO,MET) RECONSTITUTED WI...    256  4e-67
pdb|1YOI  |1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1YOH  |1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1YOG  |1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXH  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXG  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXF  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXE  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXD  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXC  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXB  |2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1VXA  |2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1U7S_A|1.40| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1U7R_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1SWM  |1.8 | 1| 153|N|MYOGLOBIN (FERRIC) COMPLEXED WITH AZID...    256  4e-67
pdb|1SPE  |2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1MYF  |NOT | 1| 153|N|MYOGLOBIN (FE II, CARBONMONOXY) (NMR, ...    256  4e-67
pdb|1MBO  |1.6 | 1| 153|N|MYOGLOBIN (OXY, $P*H 8.4)             ...    256  4e-67
pdb|1MBN  |2.0 | 1| 153|N|MYOGLOBIN                             ...    256  4e-67
pdb|1MBI  |2.0 | 1| 153|N|MYOGLOBIN (FERRIC) COMPLEX WITH IMIDAZ...    256  4e-67
pdb|1MBD  |1.4 | 1| 153|N|MYOGLOBIN (DEOXY, $P*H 8.4)           ...    256  4e-67
pdb|1MBC  |1.5 | 1| 153|N|MYOGLOBIN                             ...    256  4e-67
pdb|1L2K_A|1.50| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1JPB_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1JP9_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1JP8_A|2.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1JP6_A|2.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1IOP  |1.9 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1HJT  |1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1F6H_A|3.31| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN (MET); ...    256  4e-67
pdb|1EBC_A|1.80| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1DUK_A|2.13| 1| 153|N|MOL_ID: 1; MOLECULE: WILD-TYPE RECOMBI...    256  4e-67
pdb|1CQ2_A|2.00| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1BZR_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1BZP_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1BZ6_A|1.20| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1BVD  |1.4 | 1| 153|N|MOLECULE: APOMYOGLOBIN; OTHER_DETAILS:...    256  4e-67
pdb|1BVC  |1.5 | 1| 153|N|MOLECULE: APOMYOGLOBIN; OTHER_DETAILS:...    256  4e-67
pdb|1AJH  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|1AJG  |1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|105M  |2.02| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
pdb|104M  |1.71| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    256  4e-67
prf|690938B|myoglobin                                                  256  5e-67
pdb|1MBS  |2.5 | 1| 153|N|MYOGLOBIN (MET)                       ...    256  5e-67
pdb|2MGM  |1.9 | 1| 154|M|MYOGLOBIN (OXY) MUTANT WITH INITIATOR ...    255  5e-67
pdb|2MGL  |2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    255  5e-67
pdb|2MGK  |2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    255  5e-67
pdb|2MBW  |1.5 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|1TES  |1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|1JW8_A|1.30| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|1J52_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|1ABS  |1.5 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|112M  |2.34| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|111M  |1.88| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|110M  |1.77| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|109M  |1.83| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  5e-67
pdb|1CIO_A|1.6 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  6e-67
pdb|1V9Q_A|1.45| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  8e-67
pdb|1UFJ_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  8e-67
pdb|1MLO  |1.8 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    255  8e-67
pdb|1MLN  |2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    255  8e-67
pdb|1MLM  |1.8 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    255  8e-67
pdb|1J3F_A|1.45| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    255  8e-67
pdb|2SPO  |1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    254  1e-66
pdb|1CO9_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  1e-66
prf|742482A|myoglobin                                                  254  1e-66
prf|762517A|myoglobin                                                  254  1e-66
prf|762099A|myoglobin                                                  254  1e-66
sp|P02178|MYG_MEGNO Myoglobin.                                         254  1e-66
sp|P02194|MYG_MACRU Myoglobin.                                         254  1e-66
pdb|1MLS  |1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    254  1e-66
pdb|1MLR  |2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    254  1e-66
pdb|1MLQ  |2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    254  1e-66
pdb|1MLH  |2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    254  2e-66
pdb|1MLG  |2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    254  2e-66
pdb|1MLF  |2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    254  2e-66
pdb|2SPN  |1.7 | 1| 154|M|MYOGLOBIN (OXY) MUTANT WITH INITIATOR ...    254  2e-66
pdb|2SPM  |1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    254  2e-66
pdb|2SPL  |1.7 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    254  2e-66
pdb|2G14_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G12_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G11_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G10_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G0Z_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G0X_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G0V_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G0S_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|2G0R_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|1MOA  |1.9 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    254  2e-66
pdb|1JDO  |1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|1CP5_A|2.10| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|1CH2_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
prf|690938A|myoglobin                                                  254  2e-66
prf|0410182A|myoglobin                                                 254  2e-66
pdb|1CO8_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    254  2e-66
pdb|1MTI  |1.9 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  2e-66
pdb|1CIK_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  2e-66
pdb|1MGN  |1.9 | 1| 154|M|METMYOGLOBIN MUTANT WITH INITIATOR MET...    253  2e-66
sp|P02182|MYG_ZIPCA Myoglobin.                                         253  3e-66
pdb|1MYM  |1.7 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    253  3e-66
pdb|1MTK  |1.8 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
pdb|1MTJ  |1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
pdb|101M  |2.07| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
sp|P02180|MYG_BALPH Myoglobin.                                         253  3e-66
pdb|2OHA_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
sp|Q0KIY0|MYG_MESST Myoglobin.                                         253  3e-66
sp|P02183|MYG_MESCA Myoglobin.                                         253  3e-66
pdb|1MLL  |1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    253  3e-66
pdb|1MLK  |1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    253  3e-66
pdb|1MLJ  |2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    253  3e-66
pdb|108M  |2.67| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
pdb|107M  |2.09| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
pdb|106M  |1.99| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  3e-66
prf|0410186A|myoglobin                                                 253  3e-66
pdb|1LTW  |1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  4e-66
pdb|1CPW_A|2.20| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  4e-66
pdb|1CH3_A|2.00| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  4e-66
pdb|1CP0_A|2.00| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  4e-66
pdb|2OH8_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    253  4e-66
pdb|1MCY  |1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN (CARBON...    252  5e-66
pdb|1IRC  |2.17| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN (METAQU...    252  5e-66
pdb|2MGH  |2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    252  5e-66
pdb|2MGG  |1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    252  5e-66
pdb|2MGF  |1.8 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    252  5e-66
pdb|1CH9_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  5e-66
pdb|2OHB_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  5e-66
pdb|2OH9_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  6e-66
pdb|2MGI  |2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    252  6e-66
pdb|1MOD  |2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    252  6e-66
pdb|1MOC  |2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    252  6e-66
prf|0407214A|myoglobin                                                 252  6e-66
pdb|2BWH_A|1.9 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|2BW9_M|1.68| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|2BLJ_M|1.8 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|2BLI_A|1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|2BLH_A|1.77| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1DO7_A|1.85| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1DO4_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1DO3_A|1.55| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1DO1_A|1.50| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1CH1_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: PROTEIN (MYOGLOBI...    252  7e-66
prf|710130A|myoglobin                                                  252  7e-66
pdb|103M  |2.07| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|102M  |1.84| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    252  7e-66
pdb|1CH7_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  8e-66
pdb|1A6N  |1.15| 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  8e-66
pdb|1A6M  |1.0 | 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  8e-66
pdb|1A6K  |1.1 | 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  8e-66
pdb|1DTI_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  8e-66
pdb|2MGJ  |2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    251  9e-66
pdb|1CH5_A|2.10| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  9e-66
sp|P02195|MYG_TACAC Myoglobin.                                         251  9e-66
pdb|2MGE  |1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    251  1e-65
pdb|2MGD  |1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    251  1e-65
pdb|2MGC  |1.9 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    251  1e-65
pdb|1H1X_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  1e-65
sp|Q0KIY9|MYG_INDPC Myoglobin.                                         251  1e-65
pdb|2EVP_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  1e-65
pdb|2EVK_A|1.40| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    251  1e-65
pdb|1DUO_A|2.00| 1| 153|M|MOL_ID: 1; MOLECULE: SPERM WHALE METAQ...    251  1e-65
pdb|1DTM_A|2.13| 1| 153|M|MOL_ID: 1; MOLECULE: RECOMBINANT SPERM...    251  1e-65
tr|A6N8S4|A6N8S4_PANHO Myoglobin.                                      251  1e-65
sp|P02190|MYG_SHEEP Myoglobin.                                         251  1e-65
prf|0611200A|myoglobin                                                 251  1e-65
pdb|2MGB  |2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR ...    251  1e-65
pdb|2MGA  |2.2 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    251  1e-65
pdb|1MOB  |2.2 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATO...    251  1e-65
prf|0609177A|myoglobin                                                 251  1e-65
prf|701205A|myoglobin                                                  251  1e-65
sp|P02179|MYG_BALAC Myoglobin.                                         250  2e-65
pdb|1A6G  |1.15| 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    250  2e-65
pdb|1LUE_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    250  3e-65
sp|P02191|MYG_CEREL Myoglobin.                                         249  3e-65
pdb|1O16_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    249  4e-65
prf|0406211A|myoglobin                                                 249  4e-65
pdb|1MLU  |1.9 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH I...    249  4e-65
prf|770481A|myoglobin                                                  249  4e-65
prf|732176A|myoglobin                                                  249  5e-65
pdb|1OFK  |1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    249  6e-65
pdb|1OBM  |1.85| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  7e-65
pdb|1OFJ  |1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  7e-65
sp|P30562|MYG_PHOSI Myoglobin.                                         248  7e-65
pdb|1NAZ_A|1.04| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1N9X_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1N9I_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1N9H_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1N9F_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1MZ0_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1MYZ_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1F65_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1F63_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1DXD_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
pdb|1DXC_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    248  8e-65
sp|P02186|MYG_ELEMA Myoglobin.                                         248  1e-64
prf|1505352A|myoglobin                                                 248  1e-64
sp|P02192|MYG_BOVIN Myoglobin.                                         248  1e-64
sp|Q2MJN4|MYG_BOSMU Myoglobin.                                         248  1e-64
pdb|1FCS  |1.6 | 1| 153|M|MYOGLOBIN MUTANT WITH HIS 64 REPLACED ...    247  1e-64
tr|B0QYF8|B0QYF8_HUMAN Myoglobin (Fragment).                           247  2e-64
sp|P02187|MYG_LOXAF Myoglobin.                                         246  4e-64
prf|754930A|myoglobin                                                  246  4e-64
prf|1803210A|myoglobin                                                 246  4e-64
prf|0605259A|myoglobin                                                 246  4e-64
prf|720470A|myoglobin                                                  246  5e-64
pdb|1EMY  |1.78| 1| 153|N|MYOGLOBIN COMPLEXED WITH CYANIDE      ...    246  5e-64
sp|P84997|MYG_BUBBU Myoglobin.                                         244  1e-63
sp|Q7LZM3|MYG_PHAFI Myoglobin.                                         240  2e-62
sp|P02197|MYG_CHICK Myoglobin.                                         240  2e-62
sp|Q7LZM2|MYG_ANAPO Myoglobin.                                         240  3e-62
prf|0903180A|myoglobin                                                 239  5e-62
sp|P85077|MYG_STRCA Myoglobin.                                         237  2e-61
prf|750694A|myoglobin                                                  236  3e-61
sp|Q7LZM5|MYG_AETPY Myoglobin.                                         236  4e-61
prf|701190A|myoglobin                                                  235  9e-61
sp|Q7LZM4|MYG_CERMN Myoglobin.                                         234  2e-60
sp|P83682|MYG_DELLE Myoglobin.                                         234  2e-60
sp|Q7LZM1|MYG_URILO Myoglobin.                                         234  2e-60
tr|A6MHQ6|A6MHQ6_IGUIG Myoglobin.                                      233  3e-60
sp|P02203|MYG_VARVA Myoglobin.                                         231  9e-60
sp|P02199|MYG_APTFO Myoglobin.                                         230  2e-59
prf|0706257A|myoglobin                                                 229  4e-59
sp|P02201|MYG_GRAGE Myoglobin.                                         227  2e-58
prf|2514282A|myoglobin                                                 227  2e-58
prf|0706256A|myoglobin                                                 224  1e-57
sp|P56208|MYG_CARCR Myoglobin.                                         224  2e-57
pdb|1LHT  |2.0 | 1| 153|N|MYOGLOBIN (CYANO-MET)                 ...    221  9e-57
pdb|1LHS  |2.0 | 1| 153|N|MYOGLOBIN (AQUO-MET)                  ...    221  9e-57
sp|P02202|MYG_CHEMY Myoglobin.                                         221  2e-56
prf|0902173A|myoglobin                                                 218  1e-55
prf|3016334A|myoglobin                                                 217  3e-55
prf|1922037A|myoglobin                                                 216  3e-55
prf|0610192A|myoglobin                                                 215  7e-55
sp|P02200|MYG_ALLMI Myoglobin.                                         215  7e-55
tr|B0QYU8|B0QYU8_HUMAN Myoglobin (Fragment).                           189  5e-47
tr|Q8WVH6|Q8WVH6_HUMAN MB protein (Myoglobin).                         168  9e-41
tr|B0QYU7|B0QYU7_HUMAN Myoglobin (Fragment).                           137  3e-31
prf|2711146C|myoglobin                                                 130  3e-29
sp|Q9DGJ1|MYG_MAKNI Myoglobin.                                         130  3e-29
sp|Q7M3C1|MYG_AILME Myoglobin (Fragment).                              127  3e-28
prf|2711146D|myoglobin                                                 127  3e-28
sp|Q9DGJ0|MYG_SARCH Myoglobin.                                         127  3e-28
tr|B0QYF7|B0QYF7_HUMAN Myoglobin (Fragment).                           126  4e-28
sp|P14399|MYG_MUSAN Myoglobin.                                         126  6e-28
prf|0610174A|myoglobin                                                 125  6e-28
prf|3206363A|myoglobin                                                 125  7e-28
tr|Q2LC33|Q2LC33_CYPCA Myoglobin isoform 2.                            125  7e-28
prf|0602164A|myoglobin                                                 124  2e-27
sp|P02206|MYG_HETPO Myoglobin.                                         124  2e-27
sp|Q701N9|MYG_TETNG Myoglobin.                                         124  2e-27
prf|0612242A|myoglobin                                                 121  2e-26
pdb|1MYT  |1.74| 1| 146|N|MYOGLOBIN (MET)                       ...    121  2e-26
pdb|2NX0_A|0.95| 1| 146|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    121  2e-26
pdb|2NRL_A|0.91| 1| 146|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:...    121  2e-26
prf|2711146H|myoglobin                                                 121  2e-26
sp|P02205|MYG_THUAL Myoglobin.                                         121  2e-26
sp|Q7T044|MYG_CHARH Myoglobin.                                         120  3e-26
prf|2711146F|myoglobin                                                 120  3e-26
prf|2711146A|myoglobin                                                 120  3e-26
sp|P68190|MYG_THUTO Myoglobin.                                         120  3e-26
sp|P68189|MYG_THUTH Myoglobin.                                         120  3e-26
sp|Q76G09|MYG_THUOB Myoglobin.                                         120  3e-26
sp|Q9DEP0|MYG_CRYAN Myoglobin.                                         120  3e-26
prf|2311496A|myoglobin                                                 120  3e-26
sp|P87497|MYG_CHIRA Myoglobin.                                         120  3e-26
sp|Q9DEN9|MYG_GOBGI Myoglobin.                                         120  4e-26
sp|Q9DEN8|MYG_NOTCO Myoglobin.                                         119  5e-26
sp|P02204|MYG_CYPCA Myoglobin.                                         119  6e-26
prf|2711146B|myoglobin                                                 118  1e-25
sp|Q9DGJ2|MYG_THUAA Myoglobin.                                         118  1e-25
sp|Q9DEP1|MYG_PSEGE Myoglobin.                                         118  1e-25
sp|Q6VN46|MYG_DANRE Myoglobin.                                         117  2e-25
tr|Q90WH9|Q90WH9_HEMAM Myoglobin (Fragment).                           117  2e-25
prf|1206204A|myoglobin                                                 117  3e-25
sp|P14398|MYG_GALJA Myoglobin.                                         117  3e-25
sp|P14397|MYG_GALGA Myoglobin.                                         115  6e-25
prf|0710196A|myoglobin                                                 115  7e-25
prf|3122279A|myoglobin                                                 115  8e-25
sp|Q6I7B0|MYG_AUXRO Myoglobin.                                         115  8e-25
tr|P79846|P79846_9PERC Myoglobin (Fragment).                           115  1e-24
prf|2711146E|myoglobin                                                 114  3e-24
sp|Q9DGI9|MYG_SCOJP Myoglobin.                                         114  3e-24
tr|A1YQ89|A1YQ89_GADMO Myoglobin.                                      112  1e-23
prf|2711146G|myoglobin                                                 110  4e-23
sp|Q9DGI8|MYG_KATPE Myoglobin.                                         110  4e-23
prf|670985A|myoglobin N term fragment                                  102  7e-21
tr|Q98963|Q98963_9PERC Myoglobin (Fragment).                           100  4e-20
prf|3120322E|cytoglobin                                                 86  6e-16
tr|Q575S6|Q575S6_TETNG Cytoglobin-2.                                    86  6e-16
tr|Q8AY74|Q8AY74_9PERC Truncated myoglobin.                             84  3e-15
prf|3024324C|eye-globin                                                 84  3e-15
tr|Q5QRU6|Q5QRU6_CHICK Eye-globin.                                      84  3e-15
tr|Q8BN80|Q8BN80_MOUSE 0 day neonate eyeball cDNA, RIKEN full-le...     84  4e-15
tr|O57410|O57410_CHAGU Mutant myoglobin.                                84  5e-15
prf|2822293A|stellate cell activation-associated protein                83  7e-15
tr|Q541Y7|Q541Y7_HUMAN cDNA FLJ40738 fis, clone TKIDN2004185, we...     83  7e-15
sp|Q8WWM9|CYGB_HUMAN Cytoglobin (Histoglobin) (HGb) (Stellate ce...     83  7e-15
pdb|2DC3_B|1.68| 2| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN...     83  7e-15
pdb|2DC3_A|1.68| 2| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN...     83  7e-15
pdb|1V5H_A|2.40| 1| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN...     83  7e-15
tr|Q00M97|Q00M97_CANFA Cytoglobin.                                      83  7e-15
tr|A9JIH5|A9JIH5_SPAJD Cytoglobin.                                      82  8e-15
prf|2716209A|stellate cell activation-associated protein                82  9e-15
sp|Q921A4|CYGB_RAT Cytoglobin (Histoglobin) (HGb) (Stellate cell...     82  9e-15
tr|Q546K1|Q546K1_MOUSE Cytoglobin (Activated spleen cDNA, RIKEN ...     82  1e-14
sp|Q9CX80|CYGB_MOUSE Cytoglobin (Histoglobin) (HGb).                    82  1e-14
prf|3120322A|cytoglobin                                                 82  1e-14
sp|Q575T0|CYGB1_ORYLA Cytoglobin-1.                                     82  1e-14
prf|3024324B|cytoglobin                                                 80  4e-14
tr|Q5QRU7|Q5QRU7_CHICK Cytoglobin.                                      80  4e-14
prf|3120322D|cytoglobin                                                 80  6e-14
tr|Q575S7|Q575S7_TETNG Cytoglobin-1.                                    80  6e-14
tr|A9JIH3|A9JIH3_SPAGA Cytoglobin.                                      79  1e-13
tr|Q66IV7|Q66IV7_XENLA MGC84306 protein (Cytoglobin).                   79  1e-13
tr|Q4S9K1|Q4S9K1_TETNG Chromosome undetermined SCAF14696, whole ...     78  2e-13
pdb|1UX9_B|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1UX9_A|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1UT0_B|2.1 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1UT0_A|2.1 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1URY_B|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1URY_A|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1URV_B|2.0 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1URV_A|2.0 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNON...     77  3e-13
pdb|1UMO_B|2.59| 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNOY...     77  3e-13
pdb|1UMO_A|2.59| 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNOY...     77  3e-13
tr|A6MHQ7|A6MHQ7_IGUIG Cytoglobin-1.                                    77  4e-13
prf|3120322B|cytoglobin                                                 76  7e-13
sp|Q575S9|CYGB2_ORYLA Cytoglobin-2.                                     76  7e-13
tr|Q6DEW1|Q6DEW1_XENTR Cytoglobin.                                      74  2e-12
tr|A6MHQ8|A6MHQ8_IGUIG Cytoglobin-2.                                    73  5e-12
tr|A4IGG7|A4IGG7_DANRE Cygb2 protein.                                   72  9e-12
prf|1404348A|zeta globin                                                72  1e-11
sp|P13787|HBAZ_HORSE Hemoglobin subunit zeta (Hemoglobin zeta ch...     72  1e-11
prf|3120322C|cytoglobin                                                 72  1e-11
sp|Q575S8|CYGB2_DANRE Cytoglobin-2.                                     72  1e-11
tr|Q4RLF0|Q4RLF0_TETNG Chromosome undetermined SCAF15021, whole ...     70  3e-11
tr|B0BL37|B0BL37_CARAU Cytoglobin 1 (Fragment).                         69  8e-11
prf|2019265B|hemoglobin                                                 68  2e-10
sp|Q7LZB9|HBB_STROE Hemoglobin subunit beta (Hemoglobin beta cha...     68  2e-10
sp|Q8UUR3|CYGB1_DANRE Cytoglobin-1.                                     68  2e-10
tr|A9P2Q8|A9P2Q8_DISMA Myoglobin (Fragment).                            68  2e-10
prf|1713377A|hemoglobin                                                 68  2e-10
sp|P11342|HBB_COLLI Hemoglobin subunit beta (Hemoglobin beta cha...     68  2e-10
prf|0903200B|hemoglobin beta                                            67  4e-10
sp|P02120|HBB_ANSSE Hemoglobin subunit beta (Hemoglobin beta cha...     67  4e-10
sp|P07036|HBB_CHLME Hemoglobin subunit beta (Hemoglobin beta cha...     67  4e-10
sp|P80216|HBB_APTFO Hemoglobin subunit beta (Hemoglobin beta cha...     67  5e-10
tr|A2V8C2|A2V8C2_LAMJA Hemoglobin 4.                                    67  5e-10
prf|1408161B|hemoglobin beta                                            67  5e-10
sp|P08261|HBB_LARRI Hemoglobin subunit beta/beta' (Hemoglobin be...     67  5e-10
sp|P22742|HBB_FRAPO Hemoglobin subunit beta (Hemoglobin beta cha...     67  6e-10
prf|2704324F|Hb                                                         67  6e-10
tr|Q802S6|Q802S6_ONCMY Cytoglobin.                                      66  6e-10
tr|Q3KQ67|Q3KQ67_XENLA MGC130918 protein.                               66  6e-10
prf|0809271C|hemoglobin Abeta                                           66  6e-10
sp|P68945|HBB_CYGOL Hemoglobin subunit beta (Hemoglobin beta cha...     66  6e-10
sp|P68944|HBB_BRACA Hemoglobin subunit beta (Hemoglobin beta cha...     66  6e-10
tr|B0LCA7|B0LCA7_DISEL Myoglobin (Fragment).                            66  7e-10
prf|1603375A|beta globin                                                66  8e-10
sp|P14260|HBB_CAIMO Hemoglobin subunit beta (Hemoglobin beta cha...     66  8e-10
prf|0703209A|globin alpha                                               66  9e-10
prf|0502223B|hemoglobin beta                                            65  1e-09
sp|P02059|HBB_ERIEU Hemoglobin subunit beta (Hemoglobin beta cha...     65  1e-09
prf|1603336A|hemoglobin beta                                            65  1e-09
sp|P21668|HBB_PSIKR Hemoglobin subunit beta (Hemoglobin beta cha...     65  1e-09
prf|2119185C|hemoglobin                                                 65  1e-09
prf|0804242B|hemoglobin Abeta                                           65  1e-09
tr|P84479|P84479_MELGA Hemoglobin beta chain.                           65  1e-09
sp|P02113|HBB_PHACO Hemoglobin subunit beta (Hemoglobin beta cha...     65  1e-09
prf|0908229B|hemoglobin beta                                            65  2e-09
sp|P02122|HBB_AQUCH Hemoglobin subunit beta (Hemoglobin beta cha...     65  2e-09
prf|754400A|hemoglobin beta                                             65  2e-09
sp|P02111|HBB_ORNAN Hemoglobin subunit beta (Hemoglobin beta cha...     65  2e-09
prf|1601314B|hemoglobin beta                                            65  2e-09
sp|P15165|HBB_APUAP Hemoglobin subunit beta (Hemoglobin beta cha...     65  2e-09
tr|Q38IW1|Q38IW1_XENTR Alpha globin larval-5 (Novel protein cont...     65  2e-09
tr|Q38IW2|Q38IW2_XENTR Alpha globin larval-4.                           65  2e-09
prf|753715A|hemoglobin AIIbeta                                          64  2e-09
prf|0904282A|globin beta                                                64  2e-09
pdb|1HBR_D|2.30| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHA...     64  2e-09
pdb|1HBR_B|2.30| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHA...     64  2e-09
sp|P02112|HBB_CHICK Hemoglobin subunit beta (Hemoglobin beta cha...     64  2e-09
prf|2704324E|Hb                                                         64  2e-09
prf|0807239B|hemoglobin beta                                            64  3e-09
prf|0608224C|hemoglobin beta                                            64  3e-09
pdb|1HV4_H|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...     64  3e-09
pdb|1HV4_F|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...     64  3e-09
pdb|1HV4_D|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...     64  3e-09
pdb|1HV4_B|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-...     64  3e-09
pdb|1C40_B|2.30| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...     64  3e-09
pdb|1A4F_B|2.0 | 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN...     64  3e-09
sp|P02118|HBB_ANSIN Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|1306241C|hemoglobin beta                                            64  3e-09
sp|P08851|HBB_ACCGE Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|1512172C|hemoglobin beta                                            64  3e-09
prf|1406208B|hemoglobin beta                                            64  3e-09
prf|1304183C|hemoglobin beta                                            64  3e-09
sp|P68062|HBB_TRIOC Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
sp|P68063|HBB_GYPRU Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
sp|P68061|HBB_AEGMO Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|1004263C|hemoglobin beta                                            64  3e-09
sp|P02126|HBB_STUVU Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|2621286C|Hb                                                         64  3e-09
prf|1106157B|hemoglobin Abeta                                           64  3e-09
sp|P82113|HBB_CATMA Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
sp|P02116|HBB_ARAAR Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|1409216B|hemoglobin beta                                            64  3e-09
sp|P10058|HBB_EUDCR Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
sp|P02114|HBB_ANAPL Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|1509221B|hemoglobin beta                                            64  3e-09
prf|1005216B|hemoglobin beta                                            64  3e-09
sp|P14524|HBB_TURME Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
sp|P02121|HBB_PHORU Hemoglobin subunit beta (Hemoglobin beta cha...     64  3e-09
prf|0903202C|hemoglobin beta                                            64  4e-09
sp|P02124|HBB_RHEAM Hemoglobin subunit beta (Hemoglobin beta cha...     64  4e-09
prf|1111200C|hemoglobin beta                                            64  4e-09
sp|P07406|HBB_PASMO Hemoglobin subunit beta (Hemoglobin beta cha...     64  4e-09
prf|2806349C|hemoglobin                                                 64  4e-09
prf|1501221B|hemoglobin beta                                            64  4e-09
sp|P10782|HBB_PHACA Hemoglobin subunit beta (Hemoglobin beta cha...     64  4e-09
prf|1911215B|hemoglobin                                                 64  4e-09
sp|P30893|HBB_COTJA Hemoglobin subunit beta (Hemoglobin beta cha...     64  4e-09
prf|1302222A|globin                                                     64  4e-09
sp|P13786|HBAZ_CAPHI Hemoglobin subunit zeta (Hemoglobin zeta ch...     64  4e-09
prf|1202212C|Hb beta                                                    64  4e-09
sp|P07411|HBB_VULGR Hemoglobin subunit beta (Hemoglobin beta cha...     64  4e-09
tr|Q575S4|Q575S4_XENLA Globin Y.                                        64  5e-09
prf|2807208B|Hb                                                         64  5e-09
sp|P84792|HBB_AYTFU Hemoglobin subunit beta (Hemoglobin beta cha...     64  5e-09
tr|B2KHZ6|B2KHZ6_RHIFE Hemoglobin, beta, epsilon 4 (Predicted).         63  6e-09
tr|Q6DES4|Q6DES4_XENTR Alpha globin larval-1.                           63  6e-09
sp|P06347|HBAZ_PANTR Hemoglobin subunit zeta (Hemoglobin zeta ch...     63  7e-09
tr|B1MT33|B1MT33_CALMO Zeta globin (Predicted).                         63  7e-09
prf|2706289F|HBAZ protein                                               63  7e-09
tr|Q6IBF6|Q6IBF6_HUMAN HBZ protein (Hemoglobin, zeta).                  63  7e-09
sp|P02008|HBAZ_HUMAN Hemoglobin subunit zeta (Hemoglobin zeta ch...     63  7e-09
prf|0408492B|hemoglobin beta                                            62  9e-09
prf|0404172B|hemoglobin beta                                            62  9e-09
pdb|2PGH_D|2.8 | 4| 146|N|HEMOGLOBIN (AQUOMET)                  ...     62  9e-09
pdb|2PGH_B|2.8 | 4| 146|N|HEMOGLOBIN (AQUOMET)                  ...     62  9e-09
pdb|1QPW_D|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOB...     62  9e-09
pdb|1QPW_B|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOB...     62  9e-09
tr|Q38IW3|Q38IW3_XENTR Alpha globin larval-3.                           62  1e-08
prf|1110242C|globin alpha T5                                            62  1e-08
sp|P06638|HBA5_XENLA Hemoglobin subunit alpha-5 (Hemoglobin alph...     62  1e-08
prf|0709218A|hemoglobin beta                                            62  1e-08
pdb|1FAW_D|3.09| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...     62  1e-08
pdb|1FAW_B|3.09| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...     62  1e-08
sp|P02117|HBB_ANSAN Hemoglobin subunit beta (Hemoglobin beta cha...     62  1e-08
sp|P02093|HBB_ONDZI Hemoglobin subunit beta (Hemoglobin beta cha...     62  1e-08
sp|P02110|HBB_TACAC Hemoglobin subunit beta (Hemoglobin beta cha...     62  1e-08
prf|721937A|hemoglobin beta                                             62  1e-08
sp|Q45XH3|HBE_BRATR Hemoglobin subunit epsilon (Hemoglobin epsil...     62  1e-08
prf|1010262B|hemoglobin beta                                            62  1e-08
sp|P02125|HBB_CICCI Hemoglobin subunit beta (Hemoglobin beta cha...     62  1e-08
tr|A4ZQU5|A4ZQU5_PERMA Hemoglobin subunit zeta.                         62  1e-08
tr|B2KHZ7|B2KHZ7_RHIFE Hemoglobin, epsilon 1 (Predicted).               62  1e-08
tr|Q95233|Q95233_9PRIM Epsilon globin (Fragment).                       62  1e-08
prf|0912206B|hemoglobin beta                                            62  2e-08
tr|A4ZQV4|A4ZQV4_PERMA Hemoglobin subunit zeta.                         62  2e-08
tr|A4ZQT2|A4ZQT2_PERMA Hemoglobin subunit zeta.                         62  2e-08
tr|B0VX76|B0VX76_CALJA Zeta globin (Predicted).                         62  2e-08
tr|A4ZQW2|A4ZQW2_PERMA Hemoglobin subunit zeta.                         61  2e-08
sp|Q28338|HBE_CHEME Hemoglobin subunit epsilon (Hemoglobin epsil...     61  2e-08
prf|0608224D|hemoglobin beta                                            61  2e-08
sp|P02123|HBB_STRCA Hemoglobin subunit beta (Hemoglobin beta cha...     61  2e-08
sp|P02094|HBB_MESAU Hemoglobin subunit beta (Hemoglobin beta cha...     61  2e-08
prf|0907199B|hemoglobin beta                                            61  2e-08
sp|P02115|HBB_ANAPP Hemoglobin subunit beta (Hemoglobin beta cha...     61  2e-08
sp|P08223|HBE_EULFU Hemoglobin subunit epsilon (Hemoglobin epsil...     61  2e-08
tr|A4ZQT5|A4ZQT5_PERMA Hemoglobin subunit zeta (Embryonic alpha ...     61  2e-08
sp|Q28356|HBE_DAUMA Hemoglobin subunit epsilon (Hemoglobin epsil...     61  3e-08
prf|2002385A|beta-like globin                                           61  3e-08
prf|1204171B|hemoglobin beta                                            61  3e-08
sp|P08853|HBB_MARMA Hemoglobin subunit beta (Hemoglobin beta cha...     61  3e-08
sp|P02067|HBB_PIG Hemoglobin subunit beta (Hemoglobin beta chain...     61  3e-08
tr|A4ZQU6|A4ZQU6_PERMA Hemoglobin subunit zeta.                         61  3e-08
sp|Q28496|HBE_MICMU Hemoglobin subunit epsilon (Hemoglobin epsil...     61  3e-08
prf|0503179A|hemoglobin gamma                                           60  3e-08
sp|P02097|HBG_MACNE Hemoglobin subunit gamma (Hemoglobin gamma c...     60  3e-08
prf|0605229A|hemoglobin                                                 60  3e-08
sp|P02011|HBA3_RANCA Hemoglobin subunit alpha-3 (Hemoglobin alph...     60  3e-08
prf|0709223A|hemoglobin                                                 60  4e-08
pdb|1JEB_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...     60  4e-08
pdb|1JEB_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...     60  4e-08
sp|Q95238|HBE_PROVE Hemoglobin subunit epsilon (Hemoglobin epsil...     60  4e-08
tr|Q38IW4|Q38IW4_XENTR Alpha globin larval-2 (Putative uncharact...     60  4e-08
tr|A4ZQT3|A4ZQT3_PERMA Hemoglobin subunit zeta.                         60  4e-08
prf|1008177B|hemoglobin beta                                            60  4e-08
sp|P02085|HBB_LOXAF Hemoglobin subunit beta (Hemoglobin beta cha...     60  4e-08
prf|0910241A|globin epsilonI,beta                                       60  4e-08
sp|P02102|HBE1_CAPHI Hemoglobin subunit epsilon-1 (Hemoglobin ep...     60  4e-08
sp|Q45XJ0|HBD_LOXAF Hemoglobin subunit delta (Hemoglobin delta c...     60  5e-08
tr|Q1W6G9|Q1W6G9_HUMAN Hemoglobin zeta subunit.                         60  5e-08
prf|0707234A|globin beta-like rho                                       60  5e-08
prf|0309296B|hemoglobin beta                                            60  5e-08
sp|P02052|HBB_TUPGL Hemoglobin subunit beta (Hemoglobin beta cha...     60  5e-08
prf|711676A|globin beta                                                 60  5e-08
sp|P02108|HBB_POTTR Hemoglobin subunit beta (Hemoglobin beta cha...     60  5e-08
sp|P18435|HBE_TARSY Hemoglobin subunit epsilon (Hemoglobin epsil...     60  5e-08
prf|1212251B|hemoglobin betaII                                          60  5e-08
sp|P09421|HBB_SPECI Hemoglobin subunit beta (Hemoglobin beta cha...     60  5e-08
tr|A4ZQT9|A4ZQT9_PERMA Hemoglobin subunit zeta.                         60  5e-08
tr|A4ZQV8|A4ZQV8_PERMA Hemoglobin subunit zeta.                         60  6e-08
prf|1503170A|hemoglobin beta                                            60  6e-08
sp|Q28931|HBE_SMICR Hemoglobin subunit epsilon (Hemoglobin epsil...     60  6e-08
sp|P18707|HBB_MESBR Hemoglobin subunit beta (Hemoglobin beta cha...     60  6e-08
tr|Q28460|Q28460_MIRAN MRNA, . (Fragment).                              60  7e-08
prf|1814374A|beta globin                                                59  8e-08
tr|A4ZQV0|A4ZQV0_PERMA Hemoglobin subunit zeta.                         59  8e-08
tr|Q61600|Q61600_MOUSE Beta-H1-globin (Fragment).                       59  8e-08
sp|P04443|HBB0_MOUSE Hemoglobin subunit beta-H0 (Hemoglobin beta...     59  9e-08
tr|O88754|O88754_RAT Epsilon 3 globin (Hemoglobin, gamma A).            59  9e-08
sp|Q45XI9|HBD_ELEMA Hemoglobin subunit delta (Hemoglobin delta c...     59  1e-07
sp|P02007|HBPI_CHICK Hemoglobin subunit pi (Hemoglobin pi chain)...     59  1e-07
prf|2206405C|hemoglobin                                                 59  1e-07
tr|A4ZQT1|A4ZQT1_PERMA Hemoglobin subunit zeta.                         59  1e-07
prf|0808262B|hemoglobin beta                                            59  1e-07
sp|P02084|HBB_ELEMA Hemoglobin subunit beta (Hemoglobin beta cha...     59  1e-07
sp|P02105|HBE2_CAPHI Hemoglobin subunit epsilon-2 (Hemoglobin ep...     59  1e-07
prf|2618363A|globin                                                     59  1e-07
prf|1409215B|hemoglobin beta                                            59  1e-07
tr|A6NC93|A6NC93_HUMAN Uncharacterized protein ENSP00000346992 (...     59  1e-07
sp|P07415|HBB_TRIIN Hemoglobin subunit beta (Hemoglobin beta cha...     59  1e-07
prf|2706400B|globin                                                     59  1e-07
tr|Q9BEI1|Q9BEI1_SMICR Omega globin.                                    59  1e-07
tr|B1Q450|B1Q450_MOUSE Hemoglobin beta chain subunit.                   59  1e-07
sp|Q45XI8|HBD_TRIMA Hemoglobin subunit delta (Hemoglobin delta c...     59  1e-07
prf|2305272A|globin                                                     59  1e-07
sp|P19759|HBE_GALCR Hemoglobin subunit epsilon (Hemoglobin epsil...     59  1e-07
prf|1408288A|hemoglobin betaM                                           59  1e-07
sp|P02101|HBE_PIG Hemoglobin subunit epsilon (Hemoglobin epsilon...     59  1e-07
tr|A4ZQT6|A4ZQT6_PERMA Hemoglobin subunit zeta.                         59  1e-07
prf|1716215B|hemoglobin III beta                                        59  2e-07
sp|P18993|HBB1_VAREX Hemoglobin subunit beta-1 (Hemoglobin beta-...     59  2e-07
tr|A4ZQW6|A4ZQW6_PERMA Hemoglobin subunit zeta.                         58  2e-07
tr|Q549G1|Q549G1_HUMAN PRO2979 (Hemoglobin, gamma A).                   58  2e-07
sp|P61920|HBG1_PANTR Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
sp|Q28779|HBG1_PANPA Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
sp|P62741|HBG1_GORGO Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
prf|2618363C|globin                                                     58  2e-07
prf|711677A|hemoglobin gamma                                            58  2e-07
pdb|1I3E_B|1.86| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA ...     58  2e-07
pdb|1I3E_A|1.86| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA ...     58  2e-07
pdb|1I3D_B|1.70| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA ...     58  2e-07
pdb|1I3D_A|1.70| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA ...     58  2e-07
tr|A8DUK0|A8DUK0_MOUSE Beta-globin.                                     58  2e-07
sp|P02088|HBB1_MOUSE Hemoglobin subunit beta-1 (Hemoglobin beta-...     58  2e-07
sp|P04246|HBT_PIG Hemoglobin subunit theta (Hemoglobin theta cha...     58  2e-07
tr|A8DV41|A8DV41_MOUSE Beta-globin.                                     58  2e-07
sp|P18995|HBG1_PONPY Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
tr|A9L8Y0|A9L8Y0_PAPAN Hemoglobin subunit gamma (Predicted).            58  2e-07
sp|P68079|HBG_PAPCY Hemoglobin subunit gamma (Hemoglobin gamma c...     58  2e-07
sp|P68077|HBG_MACMU Hemoglobin subunit gamma (Hemoglobin gamma c...     58  2e-07
sp|P68078|HBG_MACFU Hemoglobin subunit gamma (Hemoglobin gamma c...     58  2e-07
tr|A4ZQV9|A4ZQV9_PERMA Hemoglobin subunit zeta.                         58  2e-07
prf|0910241B|globin epsilonII,beta                                      58  2e-07
prf|1109157B|hemoglobin beta                                            58  2e-07
prf|0709277A|globin rho'                                                58  2e-07
sp|P02127|HBRH_CHICK Hemoglobin subunit rho (Hemoglobin rho chai...     58  2e-07
sp|P07412|HBB_FELCA Hemoglobin subunit beta-A/B (Hemoglobin beta...     58  2e-07
prf|1603302A|gamma globin                                               58  2e-07
prf|1111202B|hemoglobin beta                                            58  2e-07
sp|P07410|HBB_SPETO Hemoglobin subunit beta-S/F (Hemoglobin beta...     58  2e-07
prf|1111329A|globin gamma                                               58  2e-07
prf|1813173B|globin                                                     58  2e-07
tr|B2DBE5|B2DBE5_MUSCR Hemoglobin beta 2.                               58  2e-07
prf|1208300A|hemoglobin gamma                                           58  2e-07
prf|0611197A|hemoglobin gamma                                           58  2e-07
sp|Q45XH7|HBG_ELEMA Hemoglobin subunit gamma (Hemoglobin gamma c...     58  2e-07
sp|P61947|HBG1_HYLLA Hemoglobin subunit gamma-1 (Hemoglobin gamm...     58  2e-07
tr|A9L8X9|A9L8X9_PAPAN Hemoglobin subunit gamma-1 (Predicted).          58  2e-07
prf|1004285A|globin betah0                                              58  2e-07
prf|0909303B|hemoglobin theta                                           58  2e-07
prf|2305272B|globin                                                     58  3e-07
prf|1814374B|beta globin                                                58  3e-07
sp|P19760|HBG_GALCR Hemoglobin subunit gamma (Hemoglobin gamma c...     58  3e-07
tr|Q03903|Q03903_MACMU Gamma-globin-2(A) (Gamma-globin).                58  3e-07
prf|742500A|hemoglobin alpha                                            58  3e-07
tr|Q9PVL9|Q9PVL9_HYNRE Larval alpha-globin.                             58  3e-07
sp|P01979|HBA_ORNAN Hemoglobin subunit alpha (Hemoglobin alpha c...     58  3e-07
prf|2618363D|globin                                                     58  3e-07
prf|2618363B|globin                                                     58  3e-07
prf|1413312A|embryonic globin gamma                                     58  3e-07
prf|1203223B|amylase beta                                               58  3e-07
tr|Q9QUN8|Q9QUN8_MOUSE Beta-2-globin (Fragment).                        58  3e-07
tr|Q96FH6|Q96FH6_HUMAN Hemoglobin, gamma A (Hemoglobin, gamma G)...     58  3e-07
sp|P61921|HBG2_PANTR Hemoglobin subunit gamma-2 (Hemoglobin gamm...     58  3e-07
sp|P69892|HBG2_HUMAN Hemoglobin subunit gamma-2 (Hemoglobin gamm...     58  3e-07
sp|P62742|HBG2_GORGO Hemoglobin subunit gamma-2 (Hemoglobin gamm...     58  3e-07
sp|P68012|HBB_URSTH Hemoglobin subunit beta (Hemoglobin beta cha...     58  3e-07
sp|P68013|HBB_URSML Hemoglobin subunit beta (Hemoglobin beta cha...     58  3e-07
sp|P68011|HBB_URSMA Hemoglobin subunit beta (Hemoglobin beta cha...     58  3e-07
sp|Q45XH8|HBG_LOXAF Hemoglobin subunit gamma (Hemoglobin gamma c...     58  3e-07
prf|630483A|hemoglobin gamma                                            57  3e-07
pdb|1FDH_G|2.5 | 2| 146|N|HEMOGLOBIN (DEOXY, HUMAN FETAL F=/II$=...     57  3e-07
tr|Q5D0E8|Q5D0E8_MOUSE Hbb-b2 protein.                                  57  3e-07
sp|P08422|HBA3_XENTR Hemoglobin subunit alpha-3 (Hemoglobin alph...     57  3e-07
tr|O88753|O88753_RAT Epsilon 2 globin.                                  57  3e-07
prf|2206405B|hemoglobin                                                 57  3e-07
tr|O88752|O88752_RAT Epsilon 1 globin (Hemoglobin, epsilon 1) (P...     57  3e-07
prf|2515449A|hemoglobin                                                 57  3e-07
prf|1006229B|hemoglobin beta                                            57  3e-07
prf|1004285B|globin betah1                                              57  3e-07
tr|Q5EBL1|Q5EBL1_MOUSE Hemoglobin Z, beta-like embryonic chain (...     57  3e-07
tr|Q549D9|Q549D9_MOUSE Hemoglobin beta minor (Beta-globin) (Hemo...     57  3e-07
tr|Q14491|Q14491_HUMAN Hemoglobin gamma-G (Fragment).                   57  3e-07
sp|P02090|HBB_SPAEH Hemoglobin subunit beta (Hemoglobin beta cha...     57  3e-07
sp|P04444|HBBZ_MOUSE Hemoglobin subunit beta-H1 (Hemoglobin beta...     57  3e-07
sp|P02089|HBB2_MOUSE Hemoglobin subunit beta-2 (Hemoglobin beta-...     57  3e-07
prf|671053A|hemoglobin beta                                             57  3e-07
tr|Q54AH9|Q54AH9_MOUSE Beta-2-globin (Fragment).                        57  3e-07
sp|P61948|HBG2_HYLLA Hemoglobin subunit gamma-2 (Hemoglobin gamm...     57  3e-07
tr|A8DV59|A8DV59_MOUSE Beta-globin.                                     57  4e-07
sp|P21667|HBB_LEMVA Hemoglobin subunit beta (Hemoglobin beta cha...     57  4e-07
tr|Q865L4|Q865L4_BOVIN Myoglobin (Fragment).                            57  4e-07
prf|1110232A|globin zeta,embryonic                                      57  4e-07
tr|Q78PA4|Q78PA4_MOUSE Zeta globin (Hemoglobin X, alpha-like emb...     57  4e-07
sp|P06467|HBAZ_MOUSE Hemoglobin subunit zeta (Hemoglobin zeta ch...     57  4e-07
prf|1813163B|beta-like globin y                                         57  4e-07
sp|P11025|HBE_DIDMA Hemoglobin subunit epsilon-M (Hemoglobin eps...     57  4e-07
sp|P29626|HBBY_MESAU Hemoglobin subunit beta-Y (Hemoglobin beta-...     57  4e-07
sp|P0C0U8|HBB1_DRYCE Hemoglobin subunit beta-1 (Hemoglobin beta-...     57  4e-07
tr|A8DUK2|A8DUK2_MOUSE Beta-globin.                                     57  5e-07
tr|A8DUP7|A8DUP7_MOUSE Beta-globin.                                     57  5e-07
sp|P06643|HBE4_BOVIN Hemoglobin subunit epsilon-4 (Hemoglobin ep...     57  5e-07
prf|1609086A|hemoglobin beta                                            57  5e-07
prf|1516157B|hemoglobin beta                                            57  5e-07
sp|P68045|HBB_MUSPU Hemoglobin subunit beta (Hemoglobin beta cha...     57  5e-07
sp|P68044|HBB_MUSPF Hemoglobin subunit beta (Hemoglobin beta cha...     57  5e-07
sp|P68031|HBG_ALOCA Hemoglobin subunit gamma (Hemoglobin gamma c...     57  5e-07
sp|P68030|HBG_ALOBE Hemoglobin subunit gamma (Hemoglobin gamma c...     57  5e-07
tr|A4ZR26|A4ZR26_PERMA Beta globin.                                     57  5e-07
prf|0909303C|hemoglobin zeta                                            57  5e-07
prf|0904325A|globin pi'                                                 57  5e-07
prf|2706400A|globin                                                     57  6e-07
tr|Q9BEI2|Q9BEI2_MACEU Omega globin.                                    57  6e-07
tr|Q9CZK5|Q9CZK5_MOUSE 11 days embryo whole body cDNA, RIKEN ful...     57  6e-07
prf|742499B|hemoglobin beta                                             57  6e-07
prf|0402268B|hemoglobin beta                                            57  6e-07
pdb|1FHJ_D|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...     57  6e-07
pdb|1FHJ_B|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA...     57  6e-07
sp|P60526|HBB_CHRBR Hemoglobin subunit beta (Hemoglobin beta cha...     57  6e-07
sp|P60525|HBB_CANLA Hemoglobin subunit beta (Hemoglobin beta cha...     57  6e-07
sp|P60524|HBB_CANFA Hemoglobin subunit beta (Hemoglobin beta cha...     57  6e-07
prf|1304328A|globin beta                                                57  6e-07
tr|Q9QW91|Q9QW91_9MURI Beta 2 globin.                                   57  6e-07
sp|P11517|HBB2_RAT Hemoglobin subunit beta-2 (Hemoglobin beta-2 ...     57  6e-07
sp|Q6H1U7|HBB_MACEU Hemoglobin subunit beta (Hemoglobin beta cha...     57  6e-07
tr|Q38IV9|Q38IV9_XENTR Alpha globin larval-7.                           56  6e-07
tr|B1MT80|B1MT80_CALMO G-gamma globin (Predicted).                      56  6e-07
sp|P68070|HBG_LAGLA Hemoglobin subunit gamma (Hemoglobin gamma c...     56  6e-07
sp|P68071|HBG_BRAAR Hemoglobin subunit gamma (Hemoglobin gamma c...     56  6e-07
sp|P68069|HBG_ATEPA Hemoglobin subunit gamma (Hemoglobin gamma c...     56  6e-07
sp|P68068|HBG_ATEGE Hemoglobin subunit gamma (Hemoglobin gamma c...     56  6e-07
tr|B0VXB5|B0VXB5_CALJA Hemoglobin subunit gamma (Predicted) (G-g...     56  6e-07
sp|Q9GJS7|HBG_CALJA Hemoglobin subunit gamma (Hemoglobin gamma c...     56  6e-07
sp|P18996|HBG2_PONPY Hemoglobin subunit gamma-2 (Hemoglobin gamm...     56  7e-07
sp|P24292|HBB_ECHTE Hemoglobin subunit beta (Hemoglobin beta cha...     56  7e-07
tr|Q63066|Q63066_RAT Beta-globin chain (Fragment).                      56  7e-07
tr|A8DUL0|A8DUL0_MOUSE Beta-globin.                                     56  7e-07
tr|Q63067|Q63067_RAT Beta-globin chain.                                 56  7e-07
prf|0802170A|globin beta y2 protein                                     56  7e-07
sp|P02104|HBE_MOUSE Hemoglobin subunit epsilon-Y2 (Hemoglobin ep...     56  7e-07
tr|Q9D0B2|Q9D0B2_MOUSE 10 days embryo whole body cDNA, RIKEN ful...     56  8e-07
tr|A8DUK4|A8DUK4_MOUSE Beta-globin.                                     56  8e-07
prf|1102208A|globin pi'                                                 56  8e-07
sp|P04243|HBPI_CAIMO Hemoglobin subunit pi (Hemoglobin pi chain)...     56  8e-07
tr|A8DUL7|A8DUL7_MOUSE Beta-globin.                                     56  8e-07
prf|2006316B|hemoglobin                                                 56  8e-07
prf|0408174A|hemoglobin betaII                                          56  8e-07
tr|Q9QUT6|Q9QUT6_9MURI Beta 1 globin.                                   56  8e-07
tr|Q6GPP8|Q6GPP8_XENLA MGC82702 protein.                                56  8e-07
pdb|1JEB_D|2.10| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...     56  8e-07
pdb|1JEB_B|2.10| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA C...     56  8e-07
tr|A8DUN2|A8DUN2_MOUSE Beta-globin.                                     56  8e-07
sp|Q45XI4|HBD_DENDR Hemoglobin subunit deltaH (Hemoglobin deltaH...     56  9e-07
tr|Q14403|Q14403_HUMAN Gamma-G globin (Fragment).                       56  9e-07
prf|1414223B|hemoglobin betaI                                           56  9e-07
tr|A8DUK7|A8DUK7_MOUSE Beta-globin.                                     56  9e-07
sp|P18987|HBB1_IGUIG Hemoglobin subunit beta-1 (Hemoglobin beta-...     56  9e-07
tr|Q9CR49|Q9CR49_MOUSE 10, 11 days embryo whole body cDNA, RIKEN...     56  9e-07
prf|1408162B|hemoglobin beta                                            56  1e-06
sp|P10893|HBB_LUTLU Hemoglobin subunit beta (Hemoglobin beta cha...     56  1e-06
prf|1110242B|globin alpha T4                                            56  1e-06
sp|P02009|HBAZ_PIG Hemoglobin subunit zeta (Hemoglobin zeta chai...     56  1e-06
sp|P06637|HBA4_XENLA Hemoglobin subunit alpha-4 (Hemoglobin alph...     56  1e-06
tr|A8DUQ1|A8DUQ1_MOUSE Beta-globin.                                     56  1e-06
sp|P08224|HBG_CHEME Hemoglobin subunit gamma (Hemoglobin gamma c...     56  1e-06
sp|P08225|HBG_EULFU Hemoglobin subunit gamma (Hemoglobin gamma c...     56  1e-06
tr|Q38IW0|Q38IW0_XENTR Alpha globin larval-6.                           56  1e-06
prf|1310208B|globin II beta,major                                       55  1e-06
sp|P02091|HBB1_RAT Hemoglobin subunit beta-1 (Hemoglobin beta-1 ...     55  1e-06
prf|1708165B|hemoglobin beta                                            55  1e-06
sp|P21201|HBB_VULVU Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
tr|Q90ZA5|Q90ZA5_AMBME Alpha-globin.                                    55  1e-06
tr|A8DUL2|A8DUL2_MOUSE Beta-globin.                                     55  1e-06
tr|A8DUL5|A8DUL5_MOUSE Beta-globin.                                     55  1e-06
tr|B2KHZ5|B2KHZ5_RHIFE Delta globin (Predicted).                        55  1e-06
pdb|1YGD_D|2.73| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1YGD_B|2.73| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1YEV_D|2.11| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1YEV_B|2.11| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1Y4P_D|1.98| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1Y4P_B|1.98| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1RQA_D|2.11| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
pdb|1RQA_B|2.11| 4| 146|M|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  1e-06
prf|0603229D|hemoglobin beta                                            55  1e-06
sp|P02095|HBB_CAVPO Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
tr|A8DUP5|A8DUP5_MOUSE Beta-globin.                                     55  1e-06
sp|P02055|HBB_MELME Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
prf|1110242A|globin alpha T3                                            55  1e-06
sp|P06636|HBA3_XENLA Hemoglobin subunit alpha-3 (Hemoglobin alph...     55  1e-06
prf|1718299B|hemoglobin                                                 55  1e-06
prf|1505269B|hemoglobin beta                                            55  1e-06
sp|P68046|HBB_ODORO Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
sp|P68047|HBB_ARCGA Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
prf|2303399B|hemoglobin                                                 55  1e-06
prf|2303399A|hemoglobin                                                 55  1e-06
prf|1301216B|hemoglobin beta                                            55  1e-06
tr|A8DUP0|A8DUP0_MOUSE Beta-globin.                                     55  1e-06
sp|P09909|HBB_PHOVI Hemoglobin subunit beta (Hemoglobin beta cha...     55  1e-06
sp|P56285|HBG_ALOSE Hemoglobin subunit gamma (Hemoglobin gamma c...     55  1e-06
prf|2919339B|Hb                                                         55  1e-06
tr|B0JZZ3|B0JZZ3_XENTR Putative uncharacterized protein.                55  1e-06
sp|P83613|HBA2_GOBGI Hemoglobin subunit alpha-2 (Hemoglobin alph...     55  1e-06
prf|2303399E|hemoglobin                                                 55  1e-06
sp|Q45XH5|HBG_DUGDU Hemoglobin subunit gamma (Hemoglobin gamma c...     55  1e-06
sp|P11896|HBA3_PLEWA Hemoglobin larval subunit alpha (Hemoglobin...     55  1e-06
prf|1512173B|hemoglobin beta                                            55  2e-06
sp|P15166|HBB_LEPWE Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
prf|2216270A|hemoglobin                                                 55  2e-06
prf|1404255C|hemoglobin beta                                            55  2e-06
prf|0709222F|Hb                                                         55  2e-06
sp|P02129|HBB_CRONI Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
sp|P13274|HBB_CHRPI Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
sp|Q10732|HBA_CARCR Hemoglobin subunit alpha-A (Hemoglobin alpha...     55  2e-06
prf|1104186B|hemoglobin betaI                                           55  2e-06
prf|1004267B|hemoglobin theta                                           55  2e-06
tr|A4ZQ69|A4ZQ69_PERMA Hemoglobin subunit theta.                        55  2e-06
sp|P02050|HBB_GALCR Hemoglobin subunit beta-1/2 (Hemoglobin beta...     55  2e-06
sp|Q9GLX4|HBG1_CALMO Hemoglobin subunit gamma-1 (Hemoglobin gamm...     55  2e-06
prf|1612429B|hemoglobin beta                                            55  2e-06
tr|Q533G8|Q533G8_MACEU Zeta' globin.                                    55  2e-06
prf|0804272A|hemoglobin                                                 55  2e-06
sp|P02022|HBAM_RANCA Hemoglobin heart muscle subunit alpha-type ...     55  2e-06
tr|A8DUM2|A8DUM2_MOUSE Beta-globin.                                     55  2e-06
prf|2303399C|hemoglobin                                                 55  2e-06
prf|1613153B|hemoglobin beta                                            55  2e-06
prf|1505266B|hemoglobin beta                                            55  2e-06
prf|1201238A|globin                                                     55  2e-06
sp|P68052|HBB_PTEBR Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
sp|P68053|HBB_MARFO Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
tr|A8DUQ5|A8DUQ5_MOUSE Beta-globin.                                     55  2e-06
prf|2314132A|globin                                                     55  2e-06
prf|1404405A|alpha globin                                               55  2e-06
sp|O12985|HBAD_COLLI Hemoglobin subunit alpha-D (Hemoglobin alph...     55  2e-06
prf|732172A|hemoglobin 1Balpha                                          55  2e-06
tr|A8DUP3|A8DUP3_MOUSE Beta-globin.                                     55  2e-06
sp|P01977|HBA1_TACAC Hemoglobin subunit alpha-1 (Hemoglobin alph...     55  2e-06
prf|1412195C|hemoglobin beta                                            55  2e-06
tr|A4ZQ74|A4ZQ74_PERMA Hemoglobin subunit theta.                        55  2e-06
sp|P14391|HBB_PTEAL Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
prf|1406207B|hemoglobin beta                                            55  2e-06
sp|P08259|HBB_MANSP Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
prf|1414222B|hemoglobin beta                                            55  2e-06
prf|0908261A|globin beta4                                               55  2e-06
sp|P02103|HBE_RABIT Hemoglobin subunit epsilon (Hemoglobin epsil...     55  2e-06
sp|P15449|HBB_MELCA Hemoglobin subunit beta (Hemoglobin beta cha...     55  2e-06
pdb|2B7H_D|2.20| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  2e-06
pdb|2B7H_B|2.20| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA ...     55  2e-06
prf|1412195D|hemoglobin beta                                            54  2e-06
sp|P14392|HBB_PTEPO Hemoglobin subunit beta (Hemoglobin beta cha...     54  2e-06
tr|B0VXB7|B0VXB7_CALJA A-gamma globin (Predicted).                      54  2e-06
sp|P68027|HBE_CEBPY Hemoglobin subunit epsilon (Hemoglobin epsil...     54  2e-06
sp|P68026|HBE_CALJA Hemoglobin subunit epsilon (Hemoglobin epsil...     54  2e-06
prf|1311238B|hemoglobin beta                                            54  2e-06
tr|A4ZQ79|A4ZQ79_PERMA Hemoglobin subunit theta.                        54  3e-06
prf|0812199A|globin beta-like y                                         54  3e-06
prf|0611226A|globin alpha-like pi                                       54  3e-06
tr|Q5RM02|Q5RM02_LARCR Alpha1 hemoglobin.                               54  3e-06
prf|690945A|hemoglobin beta                                             54  3e-06
tr|B1MT82|B1MT82_CALMO A-gamma globin (Predicted).                      54  3e-06
sp|P68025|HBE_CHISA Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68023|HBE_CALTO Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68022|HBE_CALMO Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68024|HBE_CALGO Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68021|HBE_CACCA Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68020|HBE_BRAAR Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68019|HBE_ATEGE Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68016|HBE_AOTAZ Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68018|HBE_ALOSE Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P68017|HBE_ALOBE Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
sp|P51438|HBE_ATEBE Hemoglobin subunit epsilon (Hemoglobin epsil...     54  3e-06
prf|2303399D|hemoglobin                                                 54  3e-06
sp|Q28932|HBB_SMICR Hemoglobin subunit beta (Hemoglobin beta cha...     54  3e-06
prf|1507316A|alpha globin                                               54  3e-06
prf|1717176A|hemoglobin alpha                                           54  3e-06
prf|1711441A|globin alpha                                               54  3e-06
sp|P23740|HBA_LATCH Hemoglobin subunit alpha (Hemoglobin alpha c...     54  3e-06
sp|P04244|HBB_PANPO Hemoglobin subunit beta (Hemoglobin beta cha...     54  3e-06
tr|Q7SYU7|Q7SYU7_XENLA MGC64476 protein.                                54  3e-06
pdb|1HDS_D|1.98| 4| 145|N|HEMOGLOBIN (SICKLE CELL)              ...     54  3e-06
pdb|1HDS_B|1.98| 4| 145|N|HEMOGLOBIN (SICKLE CELL)              ...     54  3e-06
prf|1408288B|hemoglobin epsilonM                                        54  3e-06
sp|P02109|HBB_DIDMA Hemoglobin subunit beta-M (Hemoglobin beta-M...     54  3e-06
prf|1206295B|hemoglobin beta                                            54  3e-06
sp|P02029|HBB_THEGE Hemoglobin subunit beta (Hemoglobin beta cha...     54  3e-06
tr|A9JTR0|A9JTR0_XENTR Putative uncharacterized protein.                54  4e-06

Go to top
>sp|Q9QZ76|MYG_RAT Myoglobin.
          Length = 154

 Score =  313 bits (802), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE
Sbjct: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY
Sbjct: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|2502248A|myoglobin
          Length = 153

 Score =  306 bits (783), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETL+KFDKFKNLKSEE+MKS ED
Sbjct: 1   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLDKFDKFKNLKSEEDMKSEED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS
Sbjct: 61  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|1211247A|myoglobin
          Length = 154

 Score =  296 bits (757), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 143/154 (92%), Positives = 150/154 (97%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETL+KFDKFKNLKSEE+MK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISE+II+VLKKR+
Sbjct: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>tr|Q3UVB1|Q3UVB1_MOUSE Adult male bone cDNA, RIKEN full-length
           enriched library, clone:9830004A21 product:myoglobin,
           full insert sequence.
          Length = 154

 Score =  296 bits (757), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 143/154 (92%), Positives = 150/154 (97%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETL+KFDKFKNLKSEE+MK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISE+II+VLKKR+
Sbjct: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P04247|MYG_MOUSE Myoglobin.
          Length = 154

 Score =  296 bits (757), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 143/154 (92%), Positives = 150/154 (97%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETL+KFDKFKNLKSEE+MK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISE+II+VLKKR+
Sbjct: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|1111223B|myoglobin
          Length = 153

 Score =  293 bits (751), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/153 (92%), Positives = 149/153 (97%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETL+KFDKFKNLKSEE+MK SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISE+II+VLKKR+S
Sbjct: 61  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P04248|MYG_SPAEH Myoglobin.
          Length = 154

 Score =  282 bits (722), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 138/154 (89%), Positives = 146/154 (94%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVEGDLAGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEGDLAGHGQEVLIKLFKNHPETLEKFDKFKHLKSEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQHAAEIQPLAQSHATKHKIP+KYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGQHAAEIQPLAQSHATKHKIPIKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>tr|A9JIH7|A9JIH7_SPACA Myoglobin.
          Length = 154

 Score =  280 bits (716), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/154 (88%), Positives = 144/154 (93%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL +WGKVE DLAGHGQEVLI LFK HPETLEKFDKFKNLKSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLKVWGKVESDLAGHGQEVLIKLFKNHPETLEKFDKFKNLKSEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQHAAEIQPLAQSHATKHKIP+KYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGQHAAEIQPLAQSHATKHKIPIKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P04249|MYG_PROGU Myoglobin.
          Length = 154

 Score =  277 bits (708), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (94%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVEGDL+GHGQEVLI LFK HPETLEKFDKFK+LK+E+EM++SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKGQHAAE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  ELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02171|MYG_OCHPR Myoglobin.
          Length = 154

 Score =  275 bits (703), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (93%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFKNLKSE+EMK S+
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKNHPETLEKFDKFKNLKSEDEMKGSD 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVL+ALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLSALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 154


Go to top
>prf|1111223A|myoglobin
          Length = 153

 Score =  275 bits (702), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (94%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVEGDL+GHGQEVLI LFK HPETLEKFDKFK+LK+E+EM++SE+
Sbjct: 1   GLSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQHAAE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P02164|MYG_ORYAF Myoglobin.
          Length = 154

 Score =  274 bits (701), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 144/154 (93%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ+VLN+WGKVE D+ GHGQ+VLI LFK HPETLEKFD+FK+LK+E+EMK+SE
Sbjct: 1   MGLSDAEWQLVLNVWGKVEADIPGHGQDVLIRLFKGHPETLEKFDRFKHLKTEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AEIQPLAQSHATKHKIPVKYLEFISE IIQV++ ++
Sbjct: 61  DLKKHGTTVLTALGGILKKKGQHEAEIQPLAQSHATKHKIPVKYLEFISEAIIQVIQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02156|MYG_ERIEU Myoglobin.
          Length = 154

 Score =  274 bits (701), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMKSSE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKDHPETLEKFDKFKHLKSEDEMKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH A++ PLAQSHA KHKIPVKYLEFISE IIQVLK ++
Sbjct: 61  DLKKHGTTVLTALGGILKKKGQHEAQLAPLAQSHANKHKIPVKYLEFISEAIIQVLKSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 AGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P04250|MYG_LAGMA Myoglobin.
          Length = 154

 Score =  274 bits (700), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DL GHGQEVLI LFK HPETLEKFDKFK+LK+E+EM++SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLGGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKK+GQHAAE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGTTVLTALGGILKKRGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQAAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02163|MYG_ROUAE Myoglobin.
          Length = 154

 Score =  273 bits (699), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 144/154 (93%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH A+++PLAQSHATKHKIPVKYLEFISEVIIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGQHEAQLKPLAQSHATKHKIPVKYLEFISEVIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMGKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P20856|MYG_CTEGU Myoglobin.
          Length = 154

 Score =  273 bits (698), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVETDIGGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGTTVLTALGNILKKKGQHEAELAPLAQSHATKHKIPVKYLEFISEAIIQVLESKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02165|MYG_TUPGL Myoglobin.
          Length = 154

 Score =  273 bits (698), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 144/154 (93%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LK+E+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKTEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVL+ALG ILKKKGQH AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLSALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQAAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|0804338A|myoglobin
          Length = 153

 Score =  273 bits (698), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFKNLKSE+EMK S+D
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKNHPETLEKFDKFKNLKSEDEMKGSDD 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVL+ALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLSALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|1203274A|myoglobin
          Length = 154

 Score =  273 bits (697), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P02189|MYG_PIG Myoglobin.
          Length = 154

 Score =  273 bits (697), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDMAAKYKELGFQG 154


Go to top
>prf|0912209A|myoglobin
          Length = 153

 Score =  272 bits (696), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 143/153 (93%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EWQ+VLN+WGKVE D+ GHGQ+VLI LFK HPETLEKFD+FK+LK+E+EMK+SED
Sbjct: 1   GLSDAEWQLVLNVWGKVEADIPGHGQDVLIRLFKGHPETLEKFDRFKHLKTEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AEIQPLAQSHATKHKIPVKYLEFISE IIQV++ ++S
Sbjct: 61  LKKHGTTVLTALGGILKKKGQHEAEIQPLAQSHATKHKIPVKYLEFISEAIIQVIQSKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P02168|MYG_GALCR Myoglobin.
          Length = 154

 Score =  272 bits (696), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL IWGKVE DLAGHGQ+VLI LF AHPETLEKFDKFKNLK+ +EMK+SE
Sbjct: 1   MGLSDGEWQLVLKIWGKVEADLAGHGQDVLIRLFTAHPETLEKFDKFKNLKTADEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AEI+PLAQSHATKHKIPVKYLEFISE II VL+ ++
Sbjct: 61  DLKKHGVTVLTALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLQNKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDFG D QGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFGTDVQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|751773A|myoglobin
          Length = 153

 Score =  272 bits (695), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMKSSED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKDHPETLEKFDKFKHLKSEDEMKSSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH A++ PLAQSHA KHKIPVKYLEFISE IIQVLK +++
Sbjct: 61  LKKHGTTVLTALGGILKKKGQHEAQLAPLAQSHANKHKIPVKYLEFISEAIIQVLKSKHA 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P02167|MYG_NYCCO Myoglobin.
          Length = 154

 Score =  271 bits (694), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ VLN+WGKVE DLAGHGQE+LI LF AHPETLEKFDKFKNLK+ +EMK+SE
Sbjct: 1   MGLSDGEWQSVLNVWGKVEADLAGHGQEILIRLFTAHPETLEKFDKFKNLKTPDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AEI+PLAQSHATKHKIPVKYLEFIS  II VL+ ++
Sbjct: 61  DLKKHGVTVLTALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISGAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P11343|MYG_LUTLU Myoglobin.
          Length = 154

 Score =  271 bits (694), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG+H AE++PLAQSHATKHKIP+KYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGKHEAELKPLAQSHATKHKIPIKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM +ALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKRALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02166|MYG_PERPO Myoglobin.
          Length = 154

 Score =  271 bits (694), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ VLN+WGKVE DLAGHGQE+LI LF AHPETLEKFDKFKNLK+ +EMK+SE
Sbjct: 1   MGLSDGEWQSVLNVWGKVEADLAGHGQEILIRLFTAHPETLEKFDKFKNLKTPDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE II VL+ ++
Sbjct: 61  DLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|771739A|myoglobin
          Length = 153

 Score =  271 bits (693), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 143/153 (93%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH A+++PLAQSHATKHKIPVKYLEFISEVIIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGQHEAQLKPLAQSHATKHKIPVKYLEFISEVIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMGKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|1703248C|myoglobin
          Length = 153

 Score =  271 bits (692), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNAWGKVETDIGGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGTTVLTALGNILKKKGQHEAELAPLAQSHATKHKIPVKYLEFISEAIIQVLESKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|742502A|myoglobin
          Length = 153

 Score =  271 bits (692), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 143/153 (93%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LK+E+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKTEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVL+ALG ILKKKGQH AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLSALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQ AMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQAAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|Q6PL31|MYG_OCHCU Myoglobin.
          Length = 154

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL +WGKVE DLAGHGQEVLI LFK HPETLEKFDKFKNLKSE+EMK S+
Sbjct: 1   MGLSDGEWQLVLTVWGKVEADLAGHGQEVLIRLFKNHPETLEKFDKFKNLKSEDEMKGSD 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVL+ALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGNTVLSALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAMSKALELFRND+AAKYKELGF G
Sbjct: 121 PGDFGADAQGAMSKALELFRNDMAAKYKELGFHG 154


Go to top
>prf|762534A|myoglobin
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1PMB_B|2.5 | 2| 153|N|MYOGLOBIN (AQUOMET, $P*H 7.1)            
                       
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1PMB_A|2.5 | 2| 153|N|MYOGLOBIN (AQUOMET, $P*H 7.1)            
                       
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYG_B|1.75| 2| 153|N|MYOGLOBIN (AQUOMET, PH 7.1)              
                       
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYG_A|1.75| 2| 153|N|MYOGLOBIN (AQUOMET, PH 7.1)              
                       
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MWD_B|1.80| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MWD_A|1.80| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MWC_B|1.70| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MWC_A|1.70| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  270 bits (691), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYH_B|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           LYS 45 REPLACED
          Length = 153

 Score =  270 bits (690), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFD+FK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYH_A|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           LYS 45 REPLACED
          Length = 153

 Score =  270 bits (690), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFD+FK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|732176B|myoglobin
          Length = 153

 Score =  270 bits (689), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VL IWGKVE DLAGHGQ+VLI LF AHPETLEKFDKFKNLK+ +EMK+SED
Sbjct: 1   GLSDGEWQLVLKIWGKVEADLAGHGQDVLIRLFTAHPETLEKFDKFKNLKTADEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AEI+PLAQSHATKHKIPVKYLEFISE II VL+ ++S
Sbjct: 61  LKKHGVTVLTALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLQNKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFG D QGAMSKALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGTDVQGAMSKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1YCB_B|2.1 | 2| 153|M|MYOGLOBIN (DEOXY, PH 7.1) MUTANT WITH VAL
           68 REPLACED B
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1YCB_A|2.1 | 2| 153|M|MYOGLOBIN (DEOXY, PH 7.1) MUTANT WITH VAL
           68 REPLACED B
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1YCA_B|2.2 | 2| 153|M|MYOGLOBIN (CARBONMONOXY, PH 7.1) MUTANT
           WITH VAL 68 REP
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1YCA_A|2.2 | 2| 153|M|MYOGLOBIN (CARBONMONOXY, PH 7.1) MUTANT
           WITH VAL 68 REP
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYJ_B|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           VAL 68 REPLACED
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYJ_A|1.9 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           VAL 68 REPLACED
          Length = 153

 Score =  269 bits (687), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|1309328A|myoglobin
          Length = 153

 Score =  269 bits (687), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG+H AE++PLAQSHATKHKIP+KYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGKHEAELKPLAQSHATKHKIPIKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GBFGADAQGAM +ALELFRNDIAAKYKELGFQG
Sbjct: 121 GBFGADAQGAMKRALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1MYI_B|2.0 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           LYS 45 REPLACED
          Length = 153

 Score =  269 bits (687), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFD FK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDSFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MYI_A|2.0 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           LYS 45 REPLACED
          Length = 153

 Score =  269 bits (687), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFD FK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDSFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P02170|MYG_RABIT Myoglobin.
          Length = 154

 Score =  268 bits (686), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ+VLN+WGKVE DLAGHGQEVLI LF  HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDAEWQLVLNVWGKVEADLAGHGQEVLIRLFHTHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE II VL  ++
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AMSKALELFRNDIAA+YKELGFQG
Sbjct: 121 PGDFGADAQAAMSKALELFRNDIAAQYKELGFQG 154


Go to top
>sp|P02153|MYG_CEBAP Myoglobin.
          Length = 154

 Score =  268 bits (685), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++
Sbjct: 61  ELKKHGATVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 154


Go to top
>pdb|1MNO_B|1.95| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNO_A|1.95| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MDN_B|1.98| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MDN_A|1.98| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1M6M_B|1.80| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1M6M_A|1.80| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1M6C_B|1.90| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1M6C_A|1.90| 2| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B; ENGINEERED
          Length = 153

 Score =  268 bits (684), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P02154|MYG_LAGLA Myoglobin.
          Length = 154

 Score =  267 bits (683), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/154 (83%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFIS+ II  L+K++
Sbjct: 61  ELKKHGVTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISDAIIHALQKKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P02150|MYG_MACFA Myoglobin.
          Length = 154

 Score =  267 bits (682), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/154 (83%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++
Sbjct: 61  DLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P68085|MYG_SEMEN Myoglobin.
          Length = 154

 Score =  267 bits (682), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/154 (83%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P68084|MYG_PAPAN Myoglobin.
          Length = 154

 Score =  267 bits (682), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/154 (83%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P68086|MYG_ERYPA Myoglobin.
          Length = 154

 Score =  267 bits (682), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/154 (83%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P02147|MYG_GORBE Myoglobin.
          Length = 154

 Score =  266 bits (681), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D++GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADISGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>sp|P02155|MYG_SAISC Myoglobin.
          Length = 154

 Score =  266 bits (680), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLE IS+ I+ VL+K++
Sbjct: 61  ELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 154


Go to top
>prf|762533A|myoglobin
          Length = 153

 Score =  266 bits (680), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EWQ+VLN+WGKVE DLAGHGQEVLI LF  HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDAEWQLVLNVWGKVEADLAGHGQEVLIRLFHTHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE II VL  ++ 
Sbjct: 61  LKKHGNTVLTALGAILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQ AMSKALELFRNDIAA+YKELGFQG
Sbjct: 121 GDFGADAQAAMSKALELFRNDIAAQYKELGFQG 153


Go to top
>sp|P02144|MYG_HUMAN Myoglobin.
          Length = 154

 Score =  266 bits (680), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>sp|P02152|MYG_CALJA Myoglobin.
          Length = 154

 Score =  266 bits (679), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++
Sbjct: 61  ELKKHGVTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 154


Go to top
>sp|P02151|MYG_AOTTR Myoglobin.
          Length = 154

 Score =  266 bits (679), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADVPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++
Sbjct: 61  ELKKHGVTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 154


Go to top
>prf|0611199A|myoglobin
          Length = 153

 Score =  265 bits (678), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE+
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNJ_B|2.2 | 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  265 bits (678), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T+LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTILTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNJ_A|2.2 | 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  265 bits (678), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T+LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTILTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P02145|MYG_PANTR Myoglobin.
          Length = 154

 Score =  265 bits (677), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL  ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>prf|721939B|myoglobin
          Length = 153

 Score =  265 bits (677), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|0611199B|myoglobin
          Length = 153

 Score =  265 bits (677), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|721939A|myoglobin
          Length = 153

 Score =  265 bits (676), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE ISE IIQVL+ ++ 
Sbjct: 61  LKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|732175C|myoglobin
          Length = 153

 Score =  265 bits (676), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE+
Sbjct: 1   GLSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLEFIS+ II  L+K++ 
Sbjct: 61  LKKHGVTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLEFISDAIIHALQKKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNK_B|2.2 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           HIS 64 REPLACED
          Length = 153

 Score =  265 bits (676), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNK_A|2.2 | 2| 153|M|MYOGLOBIN (AQUOMET, PH 7.1) MUTANT WITH
           HIS 64 REPLACED
          Length = 153

 Score =  265 bits (676), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTTLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|1105247A|myoglobin
          Length = 154

 Score =  265 bits (676), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGF+G
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFEG 154


Go to top
>prf|1010194A|myoglobin
          Length = 154

 Score =  265 bits (676), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGF+G
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFEG 154


Go to top
>prf|754928A|myoglobin
          Length = 153

 Score =  264 bits (675), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D++GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADISGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>prf|732175B|myoglobin
          Length = 153

 Score =  264 bits (675), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE+
Sbjct: 1   GLSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIPVKYLE IS+ I+ VL+K++ 
Sbjct: 61  LKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P02148|MYG_PONPY Myoglobin.
          Length = 154

 Score =  264 bits (675), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISESIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>pdb|1MNH|2.3 | 1| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  264 bits (674), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G  VLTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNRVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P62735|MYG_HYLSY Myoglobin.
          Length = 154

 Score =  264 bits (674), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>sp|P62734|MYG_HYLAG Myoglobin.
          Length = 154

 Score =  264 bits (674), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDMASNYKELGFQG 154


Go to top
>sp|P02181|MYG_INIGE Myoglobin.
          Length = 154

 Score =  263 bits (673), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AM+KALELFR DIAAKYKELGF G
Sbjct: 121 PGDFGADAQAAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>prf|732175A|myoglobin
          Length = 153

 Score =  263 bits (673), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE+
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++ 
Sbjct: 61  LKKHGVTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|2MM1|2.8 | 1| 153|M|MYOGLOBIN MUTANT WITH LYS 45 REPLACED BY
           ARG AND CYS 11
          Length = 153

 Score =  263 bits (673), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFD+FK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDRFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>prf|1002206A|myoglobin
          Length = 153

 Score =  263 bits (673), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLISLFK HPETLEKFDKFK+LKSE+EMK+SE+
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ I+ VL+K++ 
Sbjct: 61  LKKHGVTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P02160|MYG_VULCH Myoglobin.
          Length = 154

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>pdb|1MNI_B|2.07| 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTHLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>pdb|1MNI_A|2.07| 2| 153|M|MYOGLOBIN (MET, PH 7.1) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+AGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G T LTALG ILKKKG H AE+ PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKVGNTHLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAMSKALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGADAQGAMSKALELFRNDMAAKYKELGFQG 153


Go to top
>sp|P68082|MYG_HORSE Myoglobin.
          Length = 154

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 126/154 (81%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P68083|MYG_EQUBU Myoglobin.
          Length = 154

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 126/154 (81%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02159|MYG_LYCPI Myoglobin.
          Length = 154

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SE
Sbjct: 1   MGLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P14396|MYG_CASFI Myoglobin.
          Length = 154

 Score =  263 bits (672), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL++WGKVE DLAGHGQEVLI LFK HPETLEKF+KFK++KSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLHVWGKVEADLAGHGQEVLIRLFKGHPETLEKFNKFKHIKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG +LKKKG H AEI+PLAQSHATKHKIP+KYLEFISE II VL+ ++
Sbjct: 61  DLKKHGVTVLTALGGVLKKKGHHEAEIKPLAQSHATKHKIPIKYLEFISEAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GBFGADA GAM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PGBFGADABGAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>prf|721919A|myoglobin
          Length = 153

 Score =  263 bits (671), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL  ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>sp|P63114|MYG_OTOME Myoglobin.
          Length = 154

 Score =  263 bits (671), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SE
Sbjct: 1   MGLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P63113|MYG_CANFA Myoglobin.
          Length = 154

 Score =  263 bits (671), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SE
Sbjct: 1   MGLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           SGDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 SGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P32428|MYG_ONDZI Myoglobin.
          Length = 154

 Score =  262 bits (670), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL++WGKVE DLAGHGQ+VLI LFKAHPETLEKFDKFK++KSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLHVWGKVEADLAGHGQDVLIRLFKAHPETLEKFDKFKHIKSEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIP+KYLEFISE II VL+ ++
Sbjct: 61  DLKKHGBTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPIKYLEFISEAIIHVLZSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             BFGAD +GAM +ALELFRNDIAAKYKELGFQG
Sbjct: 121 PSBFGADVZGAMKRALELFRNDIAAKYKELGFQG 154


Go to top
>sp|P02161|MYG_ZALCA Myoglobin.
          Length = 154

 Score =  262 bits (670), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE DL GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVEADLVGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKRSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL+ ++
Sbjct: 61  DLKKHGKTVLTALGGILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGAD   AM KALELFRNDIAAKY+ELGFQG
Sbjct: 121 PGDFGADTHAAMKKALELFRNDIAAKYRELGFQG 154


Go to top
>prf|711658B|myoglobin
          Length = 153

 Score =  262 bits (670), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHK+P+KYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKVPIKYLEFISECIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>prf|761377A|myoglobin
          Length = 153

 Score =  261 bits (668), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISESIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>prf|765946A|myoglobin
          Length = 153

 Score =  261 bits (668), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LKSE+EMK SED
Sbjct: 1   GLSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKSEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++S
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|753669A|myoglobin
          Length = 153

 Score =  261 bits (667), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQLVLNIWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQ AM+KALELFR DIAAKYKELGF G
Sbjct: 121 GDFGADAQAAMNKALELFRKDIAAKYKELGFHG 153


Go to top
>sp|P02157|MYG_MELME Myoglobin.
          Length = 154

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG   AE++PLAQSHATKHKIPVKYLEFIS+ I QVL+ ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHQEAELKPLAQSHATKHKIPVKYLEFISDAIAQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+F A+AQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 PGNFAAEAQGAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|765945A|myoglobin
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SED
Sbjct: 1   GLSDGEWQLVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++S
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|765948A|myoglobin
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE DLAGHGQEVLI LFK HPETL+KFDKFK+LK+E+EMK SED
Sbjct: 1   GLSDGEWQLVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPVKYLEFIS+ IIQVL+ ++S
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDF AD + AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|754927A|myoglobin
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1K_A|1.25| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1J_A|1.4 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1I_A|1.2 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1H_A|1.3 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1G_A|1.35| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1F_A|1.2 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2V1E_A|1.3 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2IN4_A|2.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2FRK_X|1.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: X 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2FRJ_X|1.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: X 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2FRI_X|1.60| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: X 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|2FRF_A|1.20| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1YMC|2.0 | 1| 153|N|CYANOMET-SULFMYOGLOBIN (HORSE HEART)     
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1YMB|1.9 | 1| 153|N|METMYOGLOBIN (HORSE HEART)               
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1WLA|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NPG_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NPF_A|1.90| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1GJN_A|1.35| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           OTHER_DETAILS
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1DWT_A|1.4 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1DWS_A|1.45| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1DWR_A|1.45| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1AZI|2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 153

 Score =  261 bits (666), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|Q0KIY3|MYG_PENEL Myoglobin.
          Length = 154

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ++LI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDILIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGITVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>prf|0606155A|myoglobin
          Length = 153

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (91%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VL++WGKVE DLAGHGQEVLI LFK HPETLEKF+KFK++KSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLHVWGKVEADLAGHGQEVLIRLFKGHPETLEKFNKFKHIKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG +LKKKG H AEI+PLAQSHATKHKIP+KYLEFISE II VL+ ++ 
Sbjct: 61  LKKHGVTVLTALGGVLKKKGHHEAEIKPLAQSHATKHKIPIKYLEFISEAIIHVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GBFGADA GAM+KALELFR DIAAKYKELGFQG
Sbjct: 121 GBFGADABGAMNKALELFRKDIAAKYKELGFQG 153


Go to top
>prf|711658A|myoglobin
          Length = 153

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+  HGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHK+P+KYLEFISE IIQVL+ ++ 
Sbjct: 61  LKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKVPIKYLEFISECIIQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 121 GDFGADAQGAMNKALELFRKDMASNYKELGFQG 153


Go to top
>sp|P68279|MYG_TURTR Myoglobin.
          Length = 154

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>sp|P68276|MYG_DELDE Myoglobin.
          Length = 154

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>sp|Q0KIY7|MYG1_STEAT Myoglobin-1.
          Length = 154

 Score =  260 bits (665), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>sp|P02174|MYG_GLOME Myoglobin.
          Length = 154

 Score =  260 bits (664), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ++LI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDILIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>prf|742512A|myoglobin
          Length = 153

 Score =  260 bits (664), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE DL GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SED
Sbjct: 1   GLSDGEWQLVLNIWGKVEADLVGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKRSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL+ ++ 
Sbjct: 61  LKKHGKTVLTALGGILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGAD   AM KALELFRNDIAAKY+ELGFQG
Sbjct: 121 GDFGADTHAAMKKALELFRNDIAAKYRELGFQG 153


Go to top
>sp|P02173|MYG_ORCOR Myoglobin.
          Length = 154

 Score =  260 bits (664), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ++LI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDILIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>prf|1606205A|myoglobin
          Length = 153

 Score =  259 bits (663), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VL++WGKVE DLAGHGQ+VLI LFKAHPETLEKFDKFK++KSE+EMK SED
Sbjct: 1   GLSDGEWQLVLHVWGKVEADLAGHGQDVLIRLFKAHPETLEKFDKFKHIKSEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIP+KYLEFISE II VL+ ++ 
Sbjct: 61  LKKHGBTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPIKYLEFISEAIIHVLZSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            BFGAD +GAM +ALELFRNDIAAKYKELGFQG
Sbjct: 121 SBFGADVZGAMKRALELFRNDIAAKYKELGFQG 153


Go to top
>prf|690934A|myoglobin
          Length = 153

 Score =  259 bits (662), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           G+FGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NZ2_A|1.90| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  259 bits (662), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFD+FK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDEFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P02193|MYG_DIDMA Myoglobin.
          Length = 154

 Score =  259 bits (661), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKI V++LEFISE IIQV++ ++
Sbjct: 61  DLKKHGATVLTALGNILKKKGNHEAELKPLAQSHATKHKISVQFLEFISEAIIQVIQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFG DAQ AM KALELFRND+AAKYKELGFQG
Sbjct: 121 PGDFGGDAQAAMGKALELFRNDMAAKYKELGFQG 154


Go to top
>pdb|1RSE|1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: HORSE HEART
           MYOGLOBIN; CHAIN: NULL
          Length = 153

 Score =  259 bits (661), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQ HATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQDHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P68080|MYG_PHOVI Myoglobin.
          Length = 154

 Score =  258 bits (660), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEW +VLN+WGKVE DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ SE
Sbjct: 1   MGLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++
Sbjct: 61  DLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM KALELFRNDIAAKYKELGF G
Sbjct: 121 PAEFGADAQAAMKKALELFRNDIAAKYKELGFHG 154


Go to top
>sp|P68081|MYG_HALGR Myoglobin.
          Length = 154

 Score =  258 bits (660), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEW +VLN+WGKVE DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ SE
Sbjct: 1   MGLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++
Sbjct: 61  DLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM KALELFRNDIAAKYKELGF G
Sbjct: 121 PAEFGADAQAAMKKALELFRNDIAAKYKELGFHG 154


Go to top
>prf|742501A|myoglobin
          Length = 153

 Score =  258 bits (660), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG   AE++PLAQSHATKHKIPVKYLEFIS+ I QVL+ ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHQEAELKPLAQSHATKHKIPVKYLEFISDAIAQVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           G+F A+AQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 GNFAAEAQGAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1YMA|2.0 | 1| 153|M|MYOGLOBIN (HORSE HEART) MUTANT WITH HIS
           64 REPLACED BY
          Length = 153

 Score =  258 bits (660), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK+G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKYGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1HRM|1.70| 1| 153|M|MYOGLOBIN MUTANT WITH HIS 93 REPLACED BY
           TYR (H93Y)   
          Length = 153

 Score =  258 bits (660), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQS+ATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSYATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|763607A|myoglobin
          Length = 153

 Score =  258 bits (660), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E +MK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 AEFGADAQGAMNKALELFRKDIAAKYKELGFHG 153


Go to top
>prf|0407215A|myoglobin
          Length = 153

 Score =  258 bits (659), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQ++LI LFK HPETLEKFDKFK+LK+E +MK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQDILIRLFKGHPETLEKFDKFKHLKTEADMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 AEFGADAQGAMNKALELFRKDIAAKYKELGFHG 153


Go to top
>pdb|1XCH|1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 153

 Score =  258 bits (659), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KY EFIS+ II VL  ++ 
Sbjct: 61  LKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYNEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NZ5_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFD+FK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDEFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LK+HG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKEHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NZ4_A|1.80| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFD+FK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDEFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LK+HG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKEHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1NZ3_A|1.60| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFD+FK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDEFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LK+HG  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKEHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P68278|MYG_PHOPH Myoglobin.
          Length = 154

 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+GEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSEGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIA KYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIATKYKELGFHG 154


Go to top
>sp|P68277|MYG_PHODA Myoglobin.
          Length = 154

 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+GEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSEGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIA KYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIATKYKELGFHG 154


Go to top
>sp|P02169|MYG_LEPMU Myoglobin.
          Length = 154

 Score =  257 bits (657), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LF  HPETLEKFDKFK+LK+ +EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADVGGHGQEVLIRLFTGHPETLEKFDKFKHLKTADEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIP+KYLEFIS+ I+ VL  ++
Sbjct: 61  DLKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPIKYLEFISDAIVHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 PAEFGADAQAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>sp|Q0KIY6|MYG2_STEAT Myoglobin-2.
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E +MK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEADMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM+KALELFR DIA KYKELGF G
Sbjct: 121 PAEFGADAQAAMNKALELFRKDIATKYKELGFHG 154


Go to top
>pdb|1HSY|1.90| 1| 153|M|MYOGLOBIN MUTANT WITH HIS 64 REPLACED BY
           THR (H64T)   
          Length = 153

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKTGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1BJE|1.80| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 153

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN+WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKTGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFGADAQGAM+KALELFRNDIAAKYKELGFQG
Sbjct: 121 GDFGADAQGAMTKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P02184|MYG_KOGSI Myoglobin.
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK HPETLEKFD+FK+LKSE EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAMSKALELFR DIAAKYKELG+QG
Sbjct: 121 PADFGADAQGAMSKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|Q0KIY5|MYG_KOGBR Myoglobin.
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK HPETLEKFD+FK+LKSE EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAMSKALELFR DIAAKYKELG+QG
Sbjct: 121 PADFGADAQGAMSKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2JHO_A|1.4 | 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2EB9_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2EB8_A|1.65| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1UFP_A|2.10| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02185|MYG_PHYCA Myoglobin.
          Length = 154

 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|770891A|myoglobin
          Length = 153

 Score =  257 bits (656), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQ++LI LFK HPETLEKFDKFK+LK+E +MK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQDILIRLFKGHPETLEKFDKFKHLKTEADMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGAILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 AQFGADAQGAMNKALELFRKDIAAKYKELGFHG 153


Go to top
>sp|P02196|MYG_ORNAN Myoglobin.
          Length = 154

 Score =  256 bits (655), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL +WGKVEGDL GHGQEVLI LFK HPETLEKFDKFK LK+E+EMK+S 
Sbjct: 1   MGLSDGEWQLVLKVWGKVEGDLPGHGQEVLIRLFKTHPETLEKFDKFKGLKTEDEMKASA 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKI +K+LE+ISE II VL+ ++
Sbjct: 61  DLKKHGGTVLTALGNILKKKGQHEAELKPLAQSHATKHKISIKFLEYISEAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGADAQ AM KALELFRND+AAKYKE GFQG
Sbjct: 121 SADFGADAQAAMGKALELFRNDMAAKYKEFGFQG 154


Go to top
>prf|754369A|myoglobin
          Length = 153

 Score =  256 bits (654), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (89%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNAWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKI V++LEFISE IIQV++ ++ 
Sbjct: 61  LKKHGATVLTALGNILKKKGNHEAELKPLAQSHATKHKISVQFLEFISEAIIQVIQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           GDFG DAQ AM KALELFRND+AAKYKELGFQG
Sbjct: 121 GDFGGDAQAAMGKALELFRNDMAAKYKELGFQG 153


Go to top
>prf|770872A|myoglobin
          Length = 153

 Score =  256 bits (654), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/152 (79%), Positives = 136/152 (89%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK HPETLEKFD+FK+LKSE EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLKSEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+  
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPA 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAMSKALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMSKALELFRKDIAAKYKELGYQG 153


Go to top
>sp|P02177|MYG_ESCGI Myoglobin.
          Length = 154

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>sp|Q0KIY2|MYG_BALED Myoglobin.
          Length = 154

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>sp|Q0KIY1|MYG_BALBO Myoglobin.
          Length = 154

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/154 (79%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>pdb|5MBN|2.0 | 1| 153|N|MYOGLOBIN (DEOXY)                        
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|4MBN|2.0 | 1| 153|N|MYOGLOBIN (MET)                          
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MYE|1.68| 1| 153|N|MYOGLOBIN (ETHYL ISOCYANIDE, PH <<7.0)   
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MYD|1.8 | 1| 153|N|MYOGLOBIN (N-PROPYL ISOCYANIDE, PH 7.0)  
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MYC|1.8 | 1| 153|N|MYOGLOBIN (N-BUTYL ISOCYANIDE, PH 7.0)   
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MYB|1.9 | 1| 153|N|MYOGLOBIN (METHYL ISOCYANIDE, PH 7.0)    
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MYA|2.0 | 1| 153|N|MYOGLOBIN (ETHYL ISOCYANIDE, PH 7.0)     
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2MB5|1.8 | 1| 153|N|MYOGLOBIN (CARBONMONOXYMYOGLOBIN)
           (NEUTRON STUDY)     
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2D6C_B|2.26| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B           
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2D6C_A|2.26| 2| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A,
           B           
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2CMM|1.8 | 1| 153|N|MYOGLOBIN (CYANO,MET) RECONSTITUTED WITH
           IRON (III) COM
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1YOI|1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1YOH|1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1YOG|1.65| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXH|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXG|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXF|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXE|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXD|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXC|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXB|2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1VXA|2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1U7S_A|1.40| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1U7R_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1SWM|1.8 | 1| 153|N|MYOGLOBIN (FERRIC) COMPLEXED WITH AZIDE  
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1SPE|2.0 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; HETEROGEN:
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MYF|NOT | 1| 153|N|MYOGLOBIN (FE II, CARBONMONOXY) (NMR, 12
           STRUCTURES)  
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MBO|1.6 | 1| 153|N|MYOGLOBIN (OXY, $P*H 8.4)                
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MBN|2.0 | 1| 153|N|MYOGLOBIN                                
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MBI|2.0 | 1| 153|N|MYOGLOBIN (FERRIC) COMPLEX WITH IMIDAZOLE
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MBD|1.4 | 1| 153|N|MYOGLOBIN (DEOXY, $P*H 8.4)              
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1MBC|1.5 | 1| 153|N|MYOGLOBIN                                
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1L2K_A|1.50| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1JPB_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1JP9_A|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1JP8_A|2.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1JP6_A|2.30| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1IOP|1.9 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; OTHER_DETA
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1HJT|1.70| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL           
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1F6H_A|3.31| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN (MET);
           CHAIN: A        
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1EBC_A|1.80| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           BIOLOGICAL_UN
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DUK_A|2.13| 1| 153|N|MOL_ID: 1; MOLECULE: WILD-TYPE
           RECOMBINANT SPERM WHALE
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1CQ2_A|2.00| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1BZR_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           BIOLOGICAL_UN
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1BZP_A|1.15| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1BZ6_A|1.20| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1BVD|1.4 | 1| 153|N|MOLECULE: APOMYOGLOBIN; OTHER_DETAILS:
           CRYSTAL FORM B;
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1BVC|1.5 | 1| 153|N|MOLECULE: APOMYOGLOBIN; OTHER_DETAILS:
           CRYSTAL FORM D;
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1AJH|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; BIOLOGICAL
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1AJG|1.7 | 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; BIOLOGICAL
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|105M|2.02| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL           
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|104M|1.71| 1| 153|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL           
          Length = 153

 Score =  256 bits (653), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>prf|690938B|myoglobin
          Length = 153

 Score =  256 bits (653), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/153 (79%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEW +VLN+WGKVE DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ SED
Sbjct: 1   GLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           L+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++ 
Sbjct: 61  LRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQ AM KALELFRNDIAAKYKELGF G
Sbjct: 121 AEFGADAQAAMKKALELFRNDIAAKYKELGFHG 153


Go to top
>pdb|1MBS|2.5 | 1| 153|N|MYOGLOBIN (MET)                          
                       
          Length = 153

 Score =  256 bits (653), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/153 (79%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEW +VLN+WGKVE DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ SED
Sbjct: 1   GLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           L+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++ 
Sbjct: 61  LRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQ AM KALELFRNDIAAKYKELGF G
Sbjct: 121 AEFGADAQAAMKKALELFRNDIAAKYKELGFHG 153


Go to top
>pdb|2MGM|1.9 | 1| 154|M|MYOGLOBIN (OXY) MUTANT WITH INITIATOR MET
           AND ASP 122 R
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGL|2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET AND ASP 122
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGK|2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET AND
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MBW|1.5 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1TES|1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1JW8_A|1.30| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1J52_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1ABS|1.5 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|112M|2.34| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|111M|1.88| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|110M|1.77| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|109M|1.83| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  255 bits (652), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CIO_A|1.6 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (652), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHK+P+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKVPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1V9Q_A|1.45| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTGLGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1UFJ_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTGLGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLO|1.8 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, VAL 68 REPLA
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTILTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLN|2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, VAL 68 REP
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTILTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLM|1.8 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, VAL
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTILTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1J3F_A|1.45| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTGLGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2SPO|1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, LEU 29 REPLA
          Length = 154

 Score =  254 bits (650), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ+++I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIVIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CO9_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (650), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KY+EFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYVEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|742482A|myoglobin
          Length = 153

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>prf|762517A|myoglobin
          Length = 153

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (88%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SEDL
Sbjct: 2   LSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+ G
Sbjct: 62  KKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 122 DFGADAQAAMNKALELFRKDIAAKYKELGFQG 153


Go to top
>prf|762099A|myoglobin
          Length = 153

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/153 (79%), Positives = 136/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VL +WGKVEGDL GHGQEVLI LFK HPETLEKFDKFK LK+E+EMK+S D
Sbjct: 1   GLSDGEWQLVLKVWGKVEGDLPGHGQEVLIRLFKTHPETLEKFDKFKGLKTEDEMKASAD 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKI +K+LE+ISE II VL+ ++S
Sbjct: 61  LKKHGGTVLTALGNILKKKGQHEAELKPLAQSHATKHKISIKFLEYISEAIIHVLQSKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGADAQ AM KALELFRND+AAKYKE GFQG
Sbjct: 121 ADFGADAQAAMGKALELFRNDMAAKYKEFGFQG 153


Go to top
>sp|P02178|MYG_MEGNO Myoglobin.
          Length = 154

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PADFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>sp|P02194|MYG_MACRU Myoglobin.
          Length = 154

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 140/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLNIWGKVE D  GHG++VLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNIWGKVETDEGGHGKDVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPV++LEFIS+ IIQV++ ++
Sbjct: 61  DLKKHGITVLTALGNILKKKGHHEAELKPLAQSHATKHKIPVQFLEFISDAIIQVIQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +G+FGADAQ AM KALELFR+D+AAKYKE GFQG
Sbjct: 121 AGNFGADAQAAMKKALELFRHDMAAKYKEFGFQG 154


Go to top
>pdb|1MLS|1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, VAL 68 REPLA
          Length = 154

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTLLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLR|2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, VAL 68 REP
          Length = 154

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTLLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLQ|2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, VAL
          Length = 154

 Score =  254 bits (649), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T+LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTLLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLH|2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, VAL 68 REPLA
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLG|2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, VAL 68 REP
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLF|2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, VAL
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2SPN|1.7 | 1| 154|M|MYOGLOBIN (OXY) MUTANT WITH INITIATOR
           MET, LEU 29 REPLA
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2SPM|1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, ASP 122 REPL
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2SPL|1.7 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, ASP
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G14_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G12_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G11_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G10_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G0Z_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G0X_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G0V_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G0S_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2G0R_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MOA|1.9 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, LEU 29 REP
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1JDO|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CP5_A|2.10| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KY EFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYFEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CH2_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++P AQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPFAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|690938A|myoglobin
          Length = 153

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/153 (79%), Positives = 135/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLS+GEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSEGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H A ++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEANLKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM+KALELFR DIA KYKELGF G
Sbjct: 121 AEFGADAQGAMNKALELFRKDIATKYKELGFHG 153


Go to top
>prf|0410182A|myoglobin
          Length = 153

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/153 (79%), Positives = 135/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLS+GEWQ+VLN+WGKVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSEGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H A ++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEANLKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM+KALELFR DIA KYKELGF G
Sbjct: 121 AEFGADAQGAMNKALELFRKDIATKYKELGFHG 153


Go to top
>pdb|1CO8_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  254 bits (648), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KY EFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYAEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MTI|1.9 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (647), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+ K+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRLKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CIK_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (647), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHK P+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKAPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MGN|1.9 | 1| 154|M|METMYOGLOBIN MUTANT WITH INITIATOR MET,
           ASP 122 REPLACE
          Length = 154

 Score =  253 bits (647), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK+G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKYGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02182|MYG_ZIPCA Myoglobin.
          Length = 154

 Score =  253 bits (647), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SE
Sbjct: 1   MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AM+KALELFR DIAAKYKELGF G
Sbjct: 121 PSDFGADAQAAMTKALELFRKDIAAKYKELGFHG 154


Go to top
>pdb|1MYM|1.7 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, ASP
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+ K+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MTK|1.8 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+ K+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MTJ|1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+ K+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|101M|2.07| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+ K+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02180|MYG_BALPH Myoglobin.
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+D EW +VLNIW KVE D+AGHGQ++LISLFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLTDAEWHLVLNIWAKVEADVAGHGQDILISLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PADFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>pdb|2OHA_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALEL+R DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELWRKDIAAKYKELGYQG 154


Go to top
>sp|Q0KIY0|MYG_MESST Myoglobin.
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SE
Sbjct: 1   MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PSDFGADAQGAMTKALELFRKDIAAKYKELGFHG 154


Go to top
>sp|P02183|MYG_MESCA Myoglobin.
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SE
Sbjct: 1   MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PSDFGADAQGAMTKALELFRKDIAAKYKELGFHG 154


Go to top
>pdb|1MLL|1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, VAL 68 REPLA
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLK|1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, VAL 68 REP
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MLJ|2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, VAL
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|108M|2.67| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|107M|2.09| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|106M|1.99| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (646), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|0410186A|myoglobin
          Length = 153

 Score =  253 bits (645), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/152 (79%), Positives = 134/152 (88%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SEDL
Sbjct: 2   LSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+  
Sbjct: 62  KKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPA 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 122 DFGADAQAAMNKALELFRKDIAAKYKELGFQG 153


Go to top
>pdb|1LTW|1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  253 bits (645), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CPW_A|2.20| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (645), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KY EFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYWEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CH3_A|2.00| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (645), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++P AQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPWAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CP0_A|2.00| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (645), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KY EFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYNEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2OH8_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  253 bits (645), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ+ LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDWLIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MCY|1.7 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN
           (CARBONMONOXY); CHAIN: N
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1IRC|2.17| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN (METAQUO);
           CHAIN: NULL;
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQS ATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            GDFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGH|2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, HIS 64 REPLA
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGG|1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET AND WITH AS
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGF|1.8 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, ASP
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CH9_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATK KIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKQKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2OHB_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  252 bits (644), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEF SE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFWSEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2OH9_A|1.80| 1| 154|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  252 bits (644), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTWLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGI|2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, ASP 122 REPL
          Length = 154

 Score =  252 bits (643), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKTGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MOD|2.0 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, HIS 64 REP
          Length = 154

 Score =  252 bits (643), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKTGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MOC|2.0 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, HIS
          Length = 154

 Score =  252 bits (643), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKTGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|0407214A|myoglobin
          Length = 153

 Score =  252 bits (643), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 120/152 (78%), Positives = 134/152 (88%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D EW +VLNIW KVE D+AGHGQ++LISLFK HPETLEKFDKFK+LK+E EMK+SEDL
Sbjct: 2   LTDAEWHLVLNIWAKVEADVAGHGQDILISLFKGHPETLEKFDKFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+  
Sbjct: 62  KKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPA 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 122 DFGADAQAAMNKALELFRKDIAAKYKELGFQG 153


Go to top
>pdb|2BWH_A|1.9 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           MUTATION: YES
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2BW9_M|1.68| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: M;
           MUTATION: YES
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2BLJ_M|1.8 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: M;
           MUTATION: YES
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2BLI_A|1.7 | 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           MUTATION: YES
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2BLH_A|1.77| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           MUTATION: YES
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DO7_A|1.85| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DO4_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DO3_A|1.55| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DO1_A|1.50| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1CH1_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: PROTEIN (MYOGLOBIN);
           CHAIN: A; ENG
          Length = 154

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++P AQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPGAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|710130A|myoglobin
          Length = 153

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 139/153 (90%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLNIWGKVE D  GHG++VLI LFK HPETLEKFDKFK+LKSE+EMK+SED
Sbjct: 1   GLSDGEWQLVLNIWGKVETDEGGHGKDVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIPV++LEFIS+ IIQV++ +++
Sbjct: 61  LKKHGITVLTALGNILKKKGHHEAELKPLAQSHATKHKIPVQFLEFISDAIIQVIQSKHA 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           G+FGADAQ AM KALELFR+D+AAKYKE GFQG
Sbjct: 121 GNFGADAQAAMKKALELFRHDMAAKYKEFGFQG 153


Go to top
>pdb|103M|2.07| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|102M|1.84| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  252 bits (643), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CH7_A|1.90| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  251 bits (642), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATK KIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKFKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1A6N|1.15| 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; BIOLOGICAL
          Length = 151

 Score =  251 bits (642), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 118/150 (78%), Positives = 136/150 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DFGADAQGAM+KALELFR DIAAKYKELG+
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGY 151


Go to top
>pdb|1A6M|1.0 | 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; BIOLOGICAL
          Length = 151

 Score =  251 bits (642), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 118/150 (78%), Positives = 136/150 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DFGADAQGAM+KALELFR DIAAKYKELG+
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGY 151


Go to top
>pdb|1A6K|1.1 | 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; BIOLOGICAL
          Length = 151

 Score =  251 bits (642), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 118/150 (78%), Positives = 136/150 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DFGADAQGAM+KALELFR DIAAKYKELG+
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGY 151


Go to top
>pdb|1DTI_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  251 bits (642), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATK KIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKDKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGJ|2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, ASP 122 REPL
          Length = 154

 Score =  251 bits (642), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKVGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1CH5_A|2.10| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  251 bits (642), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATK KIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKVKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02195|MYG_TACAC Myoglobin.
          Length = 154

 Score =  251 bits (642), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VL +WGKVE D+ GHGQ+VLI LFK HPETLEKFDKFK+LK+E+EMK+S 
Sbjct: 1   MGLSDGEWQLVLKVWGKVETDITGHGQDVLIRLFKTHPETLEKFDKFKHLKTEDEMKASA 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG  VLTALG+ILKKKGQH AE++PLAQSHATKHKI +K+LEFISE II VL+ ++
Sbjct: 61  DLKKHGGVVLTALGSILKKKGQHEAELKPLAQSHATKHKISIKFLEFISEAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGADAQ AM KALELFRND+A KYKE GFQG
Sbjct: 121 SADFGADAQAAMGKALELFRNDMATKYKEFGFQG 154


Go to top
>pdb|2MGE|1.7 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, ASP 122 REPL
          Length = 154

 Score =  251 bits (642), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKLGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGD|1.8 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, ASP 122 RE
          Length = 154

 Score =  251 bits (642), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKLGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGC|1.9 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, HIS
          Length = 154

 Score =  251 bits (642), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKLGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1H1X_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG  VLTALG ILKKKG H AE++PLAQ HATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKHGVRVLTALGAILKKKGHHEAELKPLAQDHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|Q0KIY9|MYG_INDPC Myoglobin.
          Length = 154

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SE
Sbjct: 1   MGLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AM+KALELFR DIAAKYKELGF G
Sbjct: 121 PSDFGADAQAAMTKALELFRKDIAAKYKELGFHG 154


Go to top
>pdb|2EVP_A|1.70| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQS ATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|2EVK_A|1.40| 1| 153|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 153

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQS ATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DUO_A|2.00| 1| 153|M|MOL_ID: 1; MOLECULE: SPERM WHALE
           METAQUOMYOGLOBIN VARIA
          Length = 153

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQS ATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>pdb|1DTM_A|2.13| 1| 153|M|MOL_ID: 1; MOLECULE: RECOMBINANT SPERM
           WHALE MYOGLOBIN
          Length = 153

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQS ATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           DFGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 DFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>tr|A6N8S4|A6N8S4_PANHO Myoglobin.
          Length = 154

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAMSKALELFRND+AA+YK LGFQG
Sbjct: 121 PSDFGADAQGAMSKALELFRNDMAAQYKVLGFQG 154


Go to top
>sp|P02190|MYG_SHEEP Myoglobin.
          Length = 154

 Score =  251 bits (641), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQGAMSKALELFRND+AA+YK LGFQG
Sbjct: 121 PSDFGADAQGAMSKALELFRNDMAAQYKVLGFQG 154


Go to top
>prf|0611200A|myoglobin
          Length = 153

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (87%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SED
Sbjct: 1   GLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+ 
Sbjct: 61  LKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGADAQ AM+KALELFR DIAAKYKELGF G
Sbjct: 121 SDFGADAQAAMTKALELFRKDIAAKYKELGFHG 153


Go to top
>pdb|2MGB|2.0 | 1| 154|M|MYOGLOBIN (MET) MUTANT WITH INITIATOR
           MET, HIS 64 REPLA
          Length = 154

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKGGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|2MGA|2.2 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, HIS
          Length = 154

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKGGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MOB|2.2 | 1| 154|M|MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR
           MET, HIS 64 REP
          Length = 154

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (89%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKGGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|0609177A|myoglobin
          Length = 153

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLS+ EWQ+VL++W KVE DL+GHGQE+LI LFK HPETLEKFDKFK+LKSE EMK+SED
Sbjct: 1   GLSEAEWQLVLHVWAKVEADLSGHGQEILIRLFKGHPETLEKFDKFKHLKSEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGHTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 SDFGADAQGAMTKALELFRKDIAAKYKELGFHG 153


Go to top
>prf|701205A|myoglobin
          Length = 153

 Score =  251 bits (640), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/153 (75%), Positives = 134/153 (87%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+W KVZ B+AGHG+++LI LFK HPETLEKFDKFK+LK+E +MK+SEB
Sbjct: 1   GLSDGEWQLVLNVWAKVZABVAGHGZBLLIRLFKGHPETLEKFDKFKHLKTEADMKASEB 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AZ++PLAQSHATKHKIP+KYLEFISE II VL  R+ 
Sbjct: 61  LKKHGDTVLTALGAILKKKGHHDAZLKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             FGADAQGAM KALELFR DIAAKYKELGF G
Sbjct: 121 AQFGADAQGAMBKALELFRKDIAAKYKELGFHG 153


Go to top
>sp|P02179|MYG_BALAC Myoglobin.
          Length = 154

 Score =  250 bits (639), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 134/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EW +VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MVLSDAEWHLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 121 PAEFGADAQAAMNKALELFRKDIAAKYKELGFQG 154


Go to top
>pdb|1A6G|1.15| 1| 151|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 151

 Score =  250 bits (638), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (90%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +FGADAQGAM+KALELFR DIAAKYKELG+
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGY 151


Go to top
>pdb|1LUE_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  250 bits (638), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKDGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02191|MYG_CEREL Myoglobin.
          Length = 154

 Score =  249 bits (637), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/154 (78%), Positives = 135/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAMSKALELFRND+AA+YK LGFQG
Sbjct: 121 PSNFGADAQGAMSKALELFRNDMAAQYKVLGFQG 154


Go to top
>pdb|1O16_A|1.95| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  249 bits (637), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKDGVTSLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|0406211A|myoglobin
          Length = 153

 Score =  249 bits (636), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VL +WGKVE D+ GHGQ+VLI LFK HPETLEKFDKFK+LK+E+EMK+S D
Sbjct: 1   GLSDGEWQLVLKVWGKVETDITGHGQDVLIRLFKTHPETLEKFDKFKHLKTEDEMKASAD 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG  VLTALG+ILKKKGQH AE++PLAQSHATKHKI +K+LEFISE II VL+ ++S
Sbjct: 61  LKKHGGVVLTALGSILKKKGQHEAELKPLAQSHATKHKISIKFLEFISEAIIHVLQSKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGADAQ AM KALELFRND+A KYKE GFQG
Sbjct: 121 ADFGADAQAAMGKALELFRNDMATKYKEFGFQG 153


Go to top
>pdb|1MLU|1.9 | 1| 154|M|MYOGLOBIN (CARBONMONOXY) MUTANT WITH
           INITIATOR MET, HIS
          Length = 154

 Score =  249 bits (636), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKGGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>prf|770481A|myoglobin
          Length = 153

 Score =  249 bits (636), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (87%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD EW +VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SEDL
Sbjct: 2   LSDAEWHLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFIS+ II VL  R+  
Sbjct: 62  KKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPA 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQ AM+KALELFR DIAAKYKELGFQG
Sbjct: 122 EFGADAQAAMNKALELFRKDIAAKYKELGFQG 153


Go to top
>prf|732176A|myoglobin
          Length = 153

 Score =  249 bits (635), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/153 (77%), Positives = 134/153 (87%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LF  HPETLEKFDKFK+LK+ +EMK+SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADVGGHGQEVLIRLFTGHPETLEKFDKFKHLKTADEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKGQH AE++PLAQSHATKHKIP+KY  FIS+ I+ VL  ++ 
Sbjct: 61  LKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPIKYELFISDAIVHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQ AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 AEFGADAQAAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>pdb|1OFK|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  249 bits (635), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEK D+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKHDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKLGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1OBM|1.85| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  248 bits (634), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G T LTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVTFLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1OFJ|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN:
           NULL; ENGINEERED
          Length = 154

 Score =  248 bits (634), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 118/154 (76%), Positives = 137/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKLGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P30562|MYG_PHOSI Myoglobin.
          Length = 154

 Score =  248 bits (634), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 134/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEW +VLN+WGK E DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ S 
Sbjct: 1   MGLSDGEWHLVLNVWGKWETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSF 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++
Sbjct: 61  DLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM KALELFRNDIAAK KELGF G
Sbjct: 121 PAEFGADAQAAMKKALELFRNDIAAKIKELGFHG 154


Go to top
>pdb|1NAZ_A|1.04| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1N9X_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1N9I_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1N9H_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1N9F_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MZ0_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1MYZ_A|1.60| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1F65_A|1.70| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1F63_A|1.80| 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1DXD_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>pdb|1DXC_A|1.4 | 1| 154|M|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A;
           ENGINEERED: Y
          Length = 154

 Score =  248 bits (634), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 117/154 (75%), Positives = 136/154 (88%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+GEWQ+VL++W KVE D+AGHGQ++ I LFK+HPETLEKFD+FK+LK+E EMK+SE
Sbjct: 1   MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+
Sbjct: 61  DLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            G+FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 121 PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG 154


Go to top
>sp|P02186|MYG_ELEMA Myoglobin.
          Length = 154

 Score =  248 bits (633), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEW++VL  WGKVE D+ GHG+ V + LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWELVLKTWGKVEADIPGHGETVFVRLFTGHPETLEKFDKFKHLKTEGEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AEIQPLAQSHATKHKIP+KYLEFIS+ II VL+ ++
Sbjct: 61  DLKKQGVTVLTALGGILKKKGHHEAEIQPLAQSHATKHKIPIKYLEFISDAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 PAEFGADAQGAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|1505352A|myoglobin
          Length = 154

 Score =  248 bits (632), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AMSKALELFRND+AA+YK LGF G
Sbjct: 121 PSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG 154


Go to top
>sp|P02192|MYG_BOVIN Myoglobin.
          Length = 154

 Score =  248 bits (632), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AMSKALELFRND+AA+YK LGF G
Sbjct: 121 PSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG 154


Go to top
>sp|Q2MJN4|MYG_BOSMU Myoglobin.
          Length = 154

 Score =  248 bits (632), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AMSKALELFRND+AA+YK LGF G
Sbjct: 121 PSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG 154


Go to top
>pdb|1FCS|1.6 | 1| 153|M|MYOGLOBIN MUTANT WITH HIS 64 REPLACED BY
           VAL AND THR 67
          Length = 153

 Score =  247 bits (631), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/152 (76%), Positives = 136/152 (89%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS+GEWQ+VL++W KVE D+AGHGQ++LI LFK+HPETLEKFD+FK+LK+E EMK+SEDL
Sbjct: 2   LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDL 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           KK G  VLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  R+ G
Sbjct: 62  KKVGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPG 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +FGADAQGAM+KALELFR DIAAKYKELG+QG
Sbjct: 122 NFGADAQGAMNKALELFRKDIAAKYKELGYQG 153


Go to top
>tr|B0QYF8|B0QYF8_HUMAN Myoglobin (Fragment).
          Length = 143

 Score =  247 bits (631), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (91%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQVL+ ++
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDI 143
            GDFGADAQGAM+KALELFR D+
Sbjct: 121 PGDFGADAQGAMNKALELFRKDM 143


Go to top
>sp|P02187|MYG_LOXAF Myoglobin.
          Length = 154

 Score =  246 bits (628), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEW++VL  WGKVE D+ GHG+ VL+ LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWELVLKTWGKVEADIPGHGEFVLVRLFTGHPETLEKFDKFKHLKTEGEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKK G TVLTALG ILKKKG H AEIQPLAQSHATKHKIP+KYLEFIS+ II VL+ ++
Sbjct: 61  DLKKQGVTVLTALGGILKKKGHHEAEIQPLAQSHATKHKIPIKYLEFISDAIIHVLQSKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQ AM KALELFRNDIAAKYKELGFQG
Sbjct: 121 PAEFGADAQAAMKKALELFRNDIAAKYKELGFQG 154


Go to top
>prf|754930A|myoglobin
          Length = 153

 Score =  246 bits (628), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (87%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++ LA+SHA KHK+P+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKVPIKYLEFISDAIIHVLHAKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAMSKALELFRND+AA+YK LGFQG
Sbjct: 121 SNFGADAQGAMSKALELFRNDMAAQYKVLGFQG 153


Go to top
>prf|1803210A|myoglobin
          Length = 153

 Score =  246 bits (628), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/153 (77%), Positives = 133/153 (86%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEW +VLN+WGK E DLAGHGQEVLI LFK+HPETLEKFDKFK+LKSE++M+ S D
Sbjct: 1   GLSDGEWHLVLNVWGKWETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSFD 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           L+KHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYLEFISE II VL  ++ 
Sbjct: 61  LRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQ AM KALELFRNDIAAK KELGF G
Sbjct: 121 AEFGADAQAAMKKALELFRNDIAAKIKELGFHG 153


Go to top
>prf|0605259A|myoglobin
          Length = 153

 Score =  246 bits (627), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/153 (77%), Positives = 133/153 (86%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEW++VL  WGKVE D+ GHG+ VL+ LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWELVLKTWGKVEADIPGHGEFVLVRLFTGHPETLEKFDKFKHLKTEGEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G TVLTALG ILKKKG H AEIQPLAQSHATKHKIP+KYLEFIS+ II VL+ ++ 
Sbjct: 61  LKKQGVTVLTALGGILKKKGHHEAEIQPLAQSHATKHKIPIKYLEFISDAIIHVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 AEFGADAQGAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>prf|720470A|myoglobin
          Length = 153

 Score =  246 bits (627), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (87%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++ LA+SHA KHK+P+KYLEFIS+ II VL  ++ 
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKVPIKYLEFISDAIIHVLHAKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAMSKALELFRND+AA+YK LGFQG
Sbjct: 121 SNFGADAQGAMSKALELFRNDMAAEYKVLGFQG 153


Go to top
>pdb|1EMY|1.78| 1| 153|N|MYOGLOBIN COMPLEXED WITH CYANIDE         
                       
          Length = 153

 Score =  246 bits (627), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 132/153 (86%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEW++VL  WGKVE D+ GHG+ V + LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWELVLKTWGKVEADIPGHGETVFVRLFTGHPETLEKFDKFKHLKTEGEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKK G TVLTALG ILKKKG H AEIQPLAQSHATKHKIP+KYLEFIS+ II VL+ ++ 
Sbjct: 61  LKKQGVTVLTALGGILKKKGHHEAEIQPLAQSHATKHKIPIKYLEFISDAIIHVLQSKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM KALELFRNDIAAKYKELGFQG
Sbjct: 121 AEFGADAQGAMKKALELFRNDIAAKYKELGFQG 153


Go to top
>sp|P84997|MYG_BUBBU Myoglobin.
          Length = 154

 Score =  244 bits (624), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SE
Sbjct: 1   MGLSDGEWQLVLNAWGKVETDVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++ LA+SHA KHKIPVKYLEFIS+ II VL  ++
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHDKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGADAQ AMSKALELFRN++AA+YK LGF G
Sbjct: 121 PSDFGADAQAAMSKALELFRNEMAAQYKVLGFHG 154


Go to top
>sp|Q7LZM3|MYG_PHAFI Myoglobin.
          Length = 154

 Score =  240 bits (613), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 134/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL IWGKVE DL GHG EVL+ LF+ HPETL++F++FK LK+ ++MK+SE
Sbjct: 1   MGLSDQEWQQVLTIWGKVESDLPGHGHEVLMRLFRDHPETLDRFERFKGLKTPDQMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H +E++PLAQ+HATKHKIPVKYLEFISEVII+V+ +++
Sbjct: 61  DLKKHGVTVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SADFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>sp|P02197|MYG_CHICK Myoglobin.
          Length = 154

 Score =  240 bits (612), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 112/154 (72%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL IWGKVE D+AGHG EVL+ LF  HPETL++FDKFK LK+ ++MK SE
Sbjct: 1   MGLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGLKTPDQMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H +E++PLAQ+HATKHKIPVKYLEFISEVII+V+ +++
Sbjct: 61  DLKKHGATVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           + DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 AADFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>sp|Q7LZM2|MYG_ANAPO Myoglobin.
          Length = 154

 Score =  240 bits (612), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL IWGKVE DLAGHG  VL+ LF+ HPETL++F+KFK LK+ ++MK SE
Sbjct: 1   MGLSDQEWQQVLTIWGKVEADLAGHGHAVLMRLFQDHPETLDRFEKFKGLKTPDQMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H AE++PLAQ+HATKHKIPVKYLEFISEVII+V+ +++
Sbjct: 61  DLKKHGVTVLTQLGKILKQKGNHEAELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SADFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>prf|0903180A|myoglobin
          Length = 153

 Score =  239 bits (610), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 132/153 (86%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EWQ VL IWGKVE D+AGHG EVL+ LF  HPETL++FDKFK LK+  EMK SED
Sbjct: 1   GLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGLKTPNEMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLT LG ILK+KGQH ++++PLAQ+HATKHKIPVKYLEFISEVII+V+ ++++
Sbjct: 61  LKKHGATVLTQLGKILKQKGQHESDLKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKHA 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 ADFGADSQAAMKKALELFRNDMASKYKEFGFQG 153


Go to top
>sp|P85077|MYG_STRCA Myoglobin.
          Length = 154

 Score =  237 bits (605), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 134/154 (87%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL IWGKVE D+AGHG  +L+ LF+ HPETL++F+KFK L + E+MK+SE
Sbjct: 1   MGLSDQEWQQVLTIWGKVESDIAGHGHAILMRLFQDHPETLDRFEKFKGLTTPEQMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           +LKKHG TVLT LG ILK+KG+H AE++PLAQ+HATKHKIPVKYLEFISEVII+V+ +++
Sbjct: 61  ELKKHGVTVLTQLGKILKQKGKHEAELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SADFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>prf|750694A|myoglobin
          Length = 153

 Score =  236 bits (603), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 132/153 (86%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EWQ VL IWGKVE D+AGHG EVL+ LF  HPETL++FDKFK LK+E +MK SED
Sbjct: 1   GLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGLKTEPDMKGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG  LKKKG H A+++PLAQ+HATKHKIPVKYLEFISEVII+V+ ++++
Sbjct: 61  LKKHGQTVLTALGAQLKKKGHHEADLKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKHA 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFR+D+A+KYKE GFQG
Sbjct: 121 ADFGADSQAAMKKALELFRDDMASKYKEFGFQG 153


Go to top
>sp|Q7LZM5|MYG_AETPY Myoglobin.
          Length = 154

 Score =  236 bits (602), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 109/154 (70%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL+IWGKVE DLAGHG +VL+ LF+ HPETL++FDKFK LK+ ++MK SE
Sbjct: 1   MGLSDQEWQQVLSIWGKVESDLAGHGHQVLMRLFQDHPETLDRFDKFKGLKTPDQMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H +E++PLAQ+HATKHKIPVKYLEFISE I++V+ +++
Sbjct: 61  DLKKHGVTVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEAIMKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           + DFG D+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 AADFGGDSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>prf|701190A|myoglobin
          Length = 155

 Score =  235 bits (599), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 116/155 (74%), Positives = 129/155 (83%), Gaps = 2/155 (1%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ VLN WGKVE D+AGHGQEVLI LF  HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 1   GLSDGEWQAVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED 60

Query: 62  LKKHGCTVLTALGTILKKKGQH--AAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           LKKHG TVLTALG ILKKKG H   AE++ LA+SHA KHK+P+KYLEFIS+ II VL  +
Sbjct: 61  LKKHGNTVLTALGGILKKKGHHEAEAEVKHLAESHANKHKVPIKYLEFISDAIIHVLHAK 120

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +  +F ADAQGAMSKALELFRND A KYK LGF G
Sbjct: 121 HPSNFAADAQGAMSKALELFRNDAAEKYKVLGFHG 155


Go to top
>sp|Q7LZM4|MYG_CERMN Myoglobin.
          Length = 154

 Score =  234 bits (597), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL+IWGKVE DLAGHG +VL+ LF+ HPETL++F+KFK LK+ ++MK SE
Sbjct: 1   MGLSDQEWQQVLSIWGKVESDLAGHGHQVLMRLFQDHPETLDRFEKFKGLKTPDQMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H +E++PLAQ+HATKHKIPVKYLEFISE I++V+ +++
Sbjct: 61  DLKKHGVTVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEAIMKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           + DFG D+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 AADFGGDSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>sp|P83682|MYG_DELLE Myoglobin.
          Length = 154

 Score =  234 bits (597), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 128/154 (83%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLS+GEWQ+VL    KVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+   MK+SE
Sbjct: 1   MGLSEGEWQLVLXXXXKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTXXXMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYL    E II VL  R+
Sbjct: 61  DLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLXXXXEAIIHVLHSRH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 121 PAEFGADAQGAMNKALELFRKDIAAKYKELGFHG 154


Go to top
>sp|Q7LZM1|MYG_URILO Myoglobin.
          Length = 154

 Score =  234 bits (596), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/154 (70%), Positives = 132/154 (85%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ VL IWGKVE DLAGHG +VL+ LF+ HPETL++F+KFK LK+ ++MK SE
Sbjct: 1   MGLSDQEWQHVLTIWGKVESDLAGHGHQVLMRLFQDHPETLDRFEKFKGLKTPDQMKGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLT LG ILK+KG H +E++PLAQ+HATKHKIPVKYLEFISE II+V+ +++
Sbjct: 61  DLKKHGVTVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEAIIKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           +  FGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 ASSFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>tr|A6MHQ6|A6MHQ6_IGUIG Myoglobin.
          Length = 154

 Score =  233 bits (594), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EWQ V++IWGKVE +L  HGQEV+I LF+ HPET EKFDKFK+LKS +EMKSSE
Sbjct: 1   MGLSDQEWQKVIDIWGKVEPELPAHGQEVIIRLFQKHPETQEKFDKFKHLKSLDEMKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           ++KKHG TVLTALG ILK+KG H AE+ PLAQSHATKHKIPVKYLEFI EVI+ V+ +++
Sbjct: 61  EIKKHGTTVLTALGKILKQKGHHDAELAPLAQSHATKHKIPVKYLEFICEVIVGVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFG+++Q AM KALE+FRND+A+KYKE GFQG
Sbjct: 121 SADFGSESQAAMRKALEVFRNDMASKYKEHGFQG 154


Go to top
>sp|P02203|MYG_VARVA Myoglobin.
          Length = 154

 Score =  231 bits (590), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 131/154 (85%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EW+ V++IWGKVE DL  HGQEV+I +F+ HPET ++F KFKNLK+ +EMK+SE
Sbjct: 1   MGLSDEEWKKVVDIWGKVEPDLPSHGQEVIIRMFQNHPETQDRFAKFKNLKTLDEMKNSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DLKKHG TVLTALG ILK+KG H AEI PLAQ+HA  HKIP+KYLEFI EVI+ V+ +++
Sbjct: 61  DLKKHGTTVLTALGRILKQKGHHEAEIAPLAQTHANTHKIPIKYLEFICEVIVGVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           S DFGAD+Q AM KALELFRND+A++YKELGFQG
Sbjct: 121 SADFGADSQEAMRKALELFRNDMASRYKELGFQG 154


Go to top
>sp|P02199|MYG_APTFO Myoglobin.
          Length = 153

 Score =  230 bits (587), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 106/154 (68%), Positives = 133/154 (86%), Gaps = 1/154 (0%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGL+D EWQ VL +WGKVE DLAGHG  VL+ LFK+HPET+++FDKF+ LK+ +EM+ SE
Sbjct: 1   MGLNDQEWQQVLTMWGKVESDLAGHGHAVLMRLFKSHPETMDRFDKFRGLKTPDEMRGSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           D+KKHG TVLT LG ILKKKG H AE++PL+Q+HATKHK+PVKYLEFISE I++V+ +++
Sbjct: 61  DMKKHGVTVLT-LGQILKKKGHHEAELKPLSQTHATKHKVPVKYLEFISEAIMKVIAQKH 119

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           + +FGADAQ AM KALELFRND+A+KYKE GFQG
Sbjct: 120 ASNFGADAQEAMKKALELFRNDMASKYKEFGFQG 153


Go to top
>prf|0706257A|myoglobin
          Length = 153

 Score =  229 bits (585), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 107/153 (69%), Positives = 130/153 (84%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW+ V++IWGKVE DL  HGQEV+I +F+ HPET ++F KFKNLK+ +EMK+SED
Sbjct: 1   GLSDEEWKKVVDIWGKVEPDLPSHGQEVIIRMFQNHPETQDRFAKFKNLKTLDEMKNSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILK+KG H AEI PLAQ+HA  HKIP+KYLEFI EVI+ V+ +++S
Sbjct: 61  LKKHGTTVLTALGRILKQKGHHEAEIAPLAQTHANTHKIPIKYLEFICEVIVGVIAEKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A++YKELGFQG
Sbjct: 121 ADFGADSQEAMRKALELFRNDMASRYKELGFQG 153


Go to top
>sp|P02201|MYG_GRAGE Myoglobin.
          Length = 154

 Score =  227 bits (578), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EW  VL IW KVE DL+ HGQEV+I LF+ HPET E+F KFKNLK+ +E++SSE
Sbjct: 1   MGLSDDEWHHVLGIWAKVEPDLSAHGQEVIIRLFQVHPETQERFAKFKNLKTIDELRSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           ++KKHG TVLTALG ILK K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++
Sbjct: 61  EVKKHGTTVLTALGRILKLKNNHEPELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 PSDFGADSQAAMRKALELFRNDMASKYKEFGFQG 154


Go to top
>prf|2514282A|myoglobin
          Length = 153

 Score =  227 bits (578), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 131/153 (85%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GL+D EWQ VL +WGKVE DLAGHG  VL+ LF+ HPET+++FDKF+ LK+ +EM+ SED
Sbjct: 1   GLNDQEWQQVLTMWGKVESDLAGHGHAVLMRLFQDHPETMDRFDKFRGLKTPDEMRGSED 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLT LG ILK+KG H +E++PLAQ+HATKH++PVKYLEFISE I++V+ +++S
Sbjct: 61  MKKHGVTVLTQLGKILKQKGHHESELKPLAQTHATKHRVPVKYLEFISEAIMKVIAEKHS 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGA++Q AM KALELFR+D+A+KYKE GFQG
Sbjct: 121 ADFGANSQAAMKKALELFRHDMASKYKEFGFQG 153


Go to top
>prf|0706256A|myoglobin
          Length = 153

 Score =  224 bits (572), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/153 (67%), Positives = 127/153 (83%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW  VL IW KVE DL+ HGQEV+I LF+ HPET E+F KFKNLK+ +E++SSE+
Sbjct: 1   GLSDDEWHHVLGIWAKVEPDLSAHGQEVIIRLFQVHPETQERFAKFKNLKTIDELRSSEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLTALG ILK K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++ 
Sbjct: 61  VKKHGTTVLTALGRILKLKNNHEPELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SDFGADSQAAMRKALELFRNDMASKYKEFGFQG 153


Go to top
>sp|P56208|MYG_CARCR Myoglobin.
          Length = 154

 Score =  224 bits (570), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/154 (67%), Positives = 127/154 (82%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EW  VL IW KVE DL+ HGQEV+I LF+ HPET E+F KFKNL + + +KSSE
Sbjct: 1   MGLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           ++KKHG TVLTALG ILK+K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++
Sbjct: 61  EVKKHGTTVLTALGRILKQKNNHEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 PSDFGADSQAAMKKALELFRNDMASKYKEFGFQG 154


Go to top
>pdb|1LHT|2.0 | 1| 153|N|MYOGLOBIN (CYANO-MET)                    
                       
          Length = 153

 Score =  221 bits (564), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW  VL IW KVE DL+ HGQEV+I LF+ HPET E+F KFKNL + + +KSSE+
Sbjct: 1   GLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLTALG ILK+K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++ 
Sbjct: 61  VKKHGTTVLTALGRILKQKNNHEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SDFGADSQAAMKKALELFRNDMASKYKEFGFQG 153


Go to top
>pdb|1LHS|2.0 | 1| 153|N|MYOGLOBIN (AQUO-MET)                     
                       
          Length = 153

 Score =  221 bits (564), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW  VL IW KVE DL+ HGQEV+I LF+ HPET E+F KFKNL + + +KSSE+
Sbjct: 1   GLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLTALG ILK+K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++ 
Sbjct: 61  VKKHGTTVLTALGRILKQKNNHEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SDFGADSQAAMKKALELFRNDMASKYKEFGFQG 153


Go to top
>sp|P02202|MYG_CHEMY Myoglobin.
          Length = 154

 Score =  221 bits (562), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 103/154 (66%), Positives = 125/154 (81%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSD EW  VL IW KVE DL  HGQEV+I LF+ HPET E+F KFKNL + + +KSSE
Sbjct: 1   MGLSDDEWNHVLGIWAKVEPDLTAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           ++KKHG TVLTALG ILK+K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++
Sbjct: 61  EVKKHGTTVLTALGRILKQKNNHEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKH 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGAD+Q AM KALELFRND+A+KYKE GF G
Sbjct: 121 PSDFGADSQAAMKKALELFRNDMASKYKEFGFLG 154


Go to top
>prf|0902173A|myoglobin
          Length = 153

 Score =  218 bits (555), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/153 (66%), Positives = 124/153 (81%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW  VL IW KVE DL  HGQEV+I LF+ HPET E+F KFKNL + + +KSSE+
Sbjct: 1   GLSDDEWNHVLGIWAKVEPDLTAHGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLTALG ILK+K  H  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++ 
Sbjct: 61  VKKHGTTVLTALGRILKQKNNHEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GF G
Sbjct: 121 SDFGADSQAAMKKALELFRNDMASKYKEFGFLG 153


Go to top
>prf|3016334A|myoglobin
          Length = 142

 Score =  217 bits (552), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 114/153 (74%), Positives = 126/153 (82%), Gaps = 11/153 (7%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLS+GEWQ+VL    KVE DLAGHGQ+VLI LFK HPETLEKFDKFK+LK+    K+SED
Sbjct: 1   GLSEGEWQLVL----KVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTH---KASED 53

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TVLTALG ILKKKG H AE++PLAQSHATKHKIP+KYL    E II VL  R+ 
Sbjct: 54  LKKHGNTVLTALGGILKKKGHHDAELKPLAQSHATKHKIPIKYL----EAIIHVLHSRHP 109

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            +FGADAQGAM+KALELFR DIAAKYKELGF G
Sbjct: 110 AEFGADAQGAMNKALELFRKDIAAKYKELGFHG 142


Go to top
>prf|1922037A|myoglobin
          Length = 153

 Score =  216 bits (551), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSD EW  VL IW KVE DL+ +GQEV+I LF+ HPET E+F KFKNL + + +KSSE+
Sbjct: 1   GLSDDEWNHVLGIWAKVEPDLSANGQEVIIRLFQLHPETQERFAKFKNLTTIDALKSSEE 60

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           +KKHG TVLTALG ILK+K  +  E++PLA+SHATKHKIPVKYLEFI E+I++V+ +++ 
Sbjct: 61  VKKHGTTVLTALGRILKQKNNNEQELKPLAESHATKHKIPVKYLEFICEIIVKVIAEKHP 120

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
            DFGAD+Q AM KALELFRND+A+KYKE GFQG
Sbjct: 121 SDFGADSQAAMKKALELFRNDMASKYKEFGFQG 153


Go to top
>prf|0610192A|myoglobin
          Length = 154

 Score =  215 bits (548), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (81%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EW+ VL+IW KVE  L  HG EV+I L + HPET E+F+KFK++K+ +EMKSSE
Sbjct: 1   MELSDQEWKHVLDIWTKVESKLPEHGHEVIIRLLQEHPETQERFEKFKHMKTADEMKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +K+HG TV TALG ILK+KG HA  ++PLA+SHA +HKIPVKYLEFISE+I++V+ ++Y
Sbjct: 61  KMKQHGNTVFTALGNILKQKGNHAEVLKPLAKSHALEHKIPVKYLEFISEIIVKVIAEKY 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGAD+Q AM KALELFRND+A+KYKE G+QG
Sbjct: 121 PADFGADSQAAMRKALELFRNDMASKYKEFGYQG 154


Go to top
>sp|P02200|MYG_ALLMI Myoglobin.
          Length = 154

 Score =  215 bits (548), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (81%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD EW+ VL+IW KVE  L  HG EV+I L + HPET E+F+KFK++K+ +EMKSSE
Sbjct: 1   MELSDQEWKHVLDIWTKVESKLPEHGHEVIIRLLQEHPETQERFEKFKHMKTADEMKSSE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +K+HG TV TALG ILK+KG HA  ++PLA+SHA +HKIPVKYLEFISE+I++V+ ++Y
Sbjct: 61  KMKQHGNTVFTALGNILKQKGNHAEVLKPLAKSHALEHKIPVKYLEFISEIIVKVIAEKY 120

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
             DFGAD+Q AM KALELFRND+A+KYKE G+QG
Sbjct: 121 PADFGADSQAAMRKALELFRNDMASKYKEFGYQG 154


Go to top
>tr|B0QYU8|B0QYU8_HUMAN Myoglobin (Fragment).
          Length = 106

 Score =  189 bits (480), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 91/106 (85%), Positives = 98/106 (92%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1   MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLE 106
           DLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLE
Sbjct: 61  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLE 106


Go to top
>tr|Q8WVH6|Q8WVH6_HUMAN MB protein (Myoglobin).
          Length = 99

 Score =  168 bits (426), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 90/99 (90%)

Query: 56  MKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQV 115
           MK+SEDLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQV
Sbjct: 1   MKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQV 60

Query: 116 LKKRYSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
           L+ ++ GDFGADAQGAM+KALELFR D+A+ YKELGFQG
Sbjct: 61  LQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG 99


Go to top
>tr|B0QYU7|B0QYU7_HUMAN Myoglobin (Fragment).
          Length = 77

 Score =  137 bits (344), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%)

Query: 1  MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
          MGLSDGEWQ+VLN+WGKVE D+ GHGQEVLI LFK HPETLEKFDKFK+LKSE+EMK+SE
Sbjct: 1  MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE 60

Query: 61 DLKKHGCTVLTALGTIL 77
          DLKKHG TVLTALG IL
Sbjct: 61 DLKKHGATVLTALGGIL 77


Go to top
>prf|2711146C|myoglobin
          Length = 147

 Score =  130 bits (327), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 91/149 (61%), Gaps = 3/149 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +++MVL  WG VE D A HG  VL  LF  HPET + F KF  + ++ +M  +  +  H
Sbjct: 2   ADFEMVLKHWGPVEADYATHGNLVLTRLFTEHPETQKLFPKFAGI-AKADMAGNAAISAH 60

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
           G TVL  LG +LK KG HAA I+P+A SHATKHKIP+K  E ISEVI +V+ ++   D  
Sbjct: 61  GATVLKKLGELLKAKGSHAAIIKPMANSHATKHKIPIKNFELISEVIGKVMHEKAGLD-- 118

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A  Q A+   +     DI A YKELGF G
Sbjct: 119 AAGQKALKNVMTTIIADIEANYKELGFTG 147


Go to top
>sp|Q9DGJ1|MYG_MAKNI Myoglobin.
          Length = 147

 Score =  130 bits (327), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 91/149 (61%), Gaps = 3/149 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +++MVL  WG VE D A HG  VL  LF  HPET + F KF  + ++ +M  +  +  H
Sbjct: 2   ADFEMVLKHWGPVEADYATHGNLVLTRLFTEHPETQKLFPKFAGI-AKADMAGNAAISAH 60

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
           G TVL  LG +LK KG HAA I+P+A SHATKHKIP+K  E ISEVI +V+ ++   D  
Sbjct: 61  GATVLKKLGELLKAKGSHAAIIKPMANSHATKHKIPIKNFELISEVIGKVMHEKAGLD-- 118

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A  Q A+   +     DI A YKELGF G
Sbjct: 119 AAGQKALKNVMTTIIADIEANYKELGFTG 147


Go to top
>sp|Q7M3C1|MYG_AILME Myoglobin (Fragment).
          Length = 96

 Score =  127 bits (319), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 86/153 (56%), Gaps = 57/153 (37%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
           GLSDGEWQ+VLN+WGKVE DLAGHGQEVLI LFK HPETLEKFDKFK+LKSE   K SED
Sbjct: 1   GLSDGEWQLVLNVWGKVEADLAGHGQEVLIRLFKGHPETLEKFDKFKHLKSE---KGSED 57

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYS 121
           LKKHG TV TAL  I                                       LKK   
Sbjct: 58  LKKHGNTVETALEGI---------------------------------------LKK--- 75

Query: 122 GDFGADAQGAMSKALELFRNDIAAKYKELGFQG 154
                       KALELF+NDIAAK KELGF G
Sbjct: 76  ------------KALELFKNDIAAKTKELGFLG 96


Go to top
>prf|2711146D|myoglobin
          Length = 147

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D   HG  VL  LFK HPET + F KF  + ++ +M  +  +  HG
Sbjct: 3   DFDAVLKFWGPVEADYTSHGGLVLTRLFKEHPETQKLFPKFTGI-AQADMAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++P+A SHATKHKIP+   + ISE+I++V++++   D G 
Sbjct: 62  ATVLKKLGELLKAKGNHAAILKPMANSHATKHKIPINNFKLISEIIVKVMQEKAGMDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   +     D+ A YKELGF G
Sbjct: 121 -GQQALRNVMAAVIADLEANYKELGFSG 147


Go to top
>sp|Q9DGJ0|MYG_SARCH Myoglobin.
          Length = 147

 Score =  127 bits (318), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D   HG  VL  LFK HPET + F KF  + ++ +M  +  +  HG
Sbjct: 3   DFDAVLKFWGPVEADYTSHGGLVLTRLFKEHPETQKLFPKFTGI-AQADMAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++P+A SHATKHKIP+   + ISE+I++V++++   D G 
Sbjct: 62  ATVLKKLGELLKAKGNHAAILKPMANSHATKHKIPINNFKLISEIIVKVMQEKAGMDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   +     D+ A YKELGF G
Sbjct: 121 -GQQALRNVMAAVIADLEANYKELGFSG 147


Go to top
>tr|B0QYF7|B0QYF7_HUMAN Myoglobin (Fragment).
          Length = 74

 Score =  126 bits (317), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/74 (83%), Positives = 67/74 (90%)

Query: 56  MKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQV 115
           MK+SEDLKKHG TVLTALG ILKKKG H AEI+PLAQSHATKHKIPVKYLEFISE IIQV
Sbjct: 1   MKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQV 60

Query: 116 LKKRYSGDFGADAQ 129
           L+ ++ GDFGADAQ
Sbjct: 61  LQSKHPGDFGADAQ 74


Go to top
>sp|P14399|MYG_MUSAN Myoglobin.
          Length = 149

 Score =  126 bits (316), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 89/148 (60%), Gaps = 1/148 (0%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +W+ V ++W  VE DL   GQ +L+ LF+ +PE+   F KFKN KS  E+K + D+K   
Sbjct: 3   DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQA 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL+ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  A
Sbjct: 62  DTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNA 121

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A S A ++  +DI  +YK   FQG
Sbjct: 122 QVQAAFSGAFKIICSDIEKEYKAANFQG 149


Go to top
>prf|0610174A|myoglobin
          Length = 148

 Score =  125 bits (315), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 89/148 (60%), Gaps = 1/148 (0%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +W+ V ++W  VE DL   GQ +L+ LF+ +PE+   F KFKN KS  E+K + D+K   
Sbjct: 2   DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQA 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL+ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  A
Sbjct: 61  DTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNA 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A S A ++  +DI  +YK   FQG
Sbjct: 121 QVQAAFSGAFKIICSDIEKEYKAANFQG 148


Go to top
>prf|3206363A|myoglobin
          Length = 147

 Score =  125 bits (315), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +++  L  WG +E D AGHG EVL  LFK HP+TL+ F KFK +  + E+     +  HG
Sbjct: 3   DYERFLKCWGAIEADYAGHGGEVLTRLFKEHPDTLKLFPKFKGI-PQSELAGDTLVASHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +L+ KG HAA +QPLA +HA KHKI +     I+EV+++V+ ++   D   
Sbjct: 62  ATVLKKLGELLRAKGDHAAILQPLATTHANKHKIALNNFRLITEVLVKVMAEKAGLDTA- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             QGA+ + ++    DI   YKE+GF G
Sbjct: 121 -GQGALKRVMDCIIRDIDRYYKEIGFAG 147


Go to top
>tr|Q2LC33|Q2LC33_CYPCA Myoglobin isoform 2.
          Length = 147

 Score =  125 bits (315), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +++  L  WG +E D AGHG EVL  LFK HP+TL+ F KFK +  + E+     +  HG
Sbjct: 3   DYERFLKCWGAIEADYAGHGGEVLTRLFKEHPDTLKLFPKFKGI-PQSELAGDTLVASHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +L+ KG HAA +QPLA +HA KHKI +     I+EV+++V+ ++   D   
Sbjct: 62  ATVLKKLGELLRAKGDHAAILQPLATTHANKHKIALNNFRLITEVLVKVMAEKAGLDTA- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             QGA+ + ++    DI   YKE+GF G
Sbjct: 121 -GQGALKRVMDCIIRDIDRYYKEIGFAG 147


Go to top
>prf|0602164A|myoglobin
          Length = 148

 Score =  124 bits (312), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 89/148 (60%), Gaps = 1/148 (0%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           EW+ V  +W  VE D+   G  +L+ LFK H ET + F KFK +  ++ + ++EDL+KHG
Sbjct: 2   EWEHVNKVWAVVEPDIPAVGLAILLRLFKEHKETKDLFPKFKEIPVQQ-LGNNEDLRKHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL ALG ILK+KG+H+  ++ LA +H  KHKIP K    I+ + ++VL + Y  D   
Sbjct: 61  VTVLRALGNILKQKGKHSTNVKELADTHINKHKIPPKNFVLITNIAVKVLTEMYPSDMTG 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q + SK   +  +D+   YKE  FQG
Sbjct: 121 PMQESFSKVFTVICSDLETLYKEANFQG 148


Go to top
>sp|P02206|MYG_HETPO Myoglobin.
          Length = 149

 Score =  124 bits (312), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 89/148 (60%), Gaps = 1/148 (0%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           EW+ V  +W  VE D+   G  +L+ LFK H ET + F KFK +  ++ + ++EDL+KHG
Sbjct: 3   EWEHVNKVWAVVEPDIPAVGLAILLRLFKEHKETKDLFPKFKEIPVQQ-LGNNEDLRKHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL ALG ILK+KG+H+  ++ LA +H  KHKIP K    I+ + ++VL + Y  D   
Sbjct: 62  VTVLRALGNILKQKGKHSTNVKELADTHINKHKIPPKNFVLITNIAVKVLTEMYPSDMTG 121

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q + SK   +  +D+   YKE  FQG
Sbjct: 122 PMQESFSKVFTVICSDLETLYKEANFQG 149


Go to top
>sp|Q701N9|MYG_TETNG Myoglobin.
          Length = 146

 Score =  124 bits (311), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
           G++ MVL  WG VE D + HG  VL  LF  +PET + F KF  + ++ E+  +  +  H
Sbjct: 2   GDFDMVLKFWGPVEADYSAHGGMVLTRLFTENPETQQLFPKFVGI-AQSELAGNAAVSAH 60

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
           G TVL  LG +LK KG HAA +QPLA SHATKHKIP+K  + I+EVI +V+ ++   D  
Sbjct: 61  GATVLKKLGELLKAKGNHAAILQPLANSHATKHKIPIKNFKLIAEVIGKVMAEKAGLD-- 118

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGF 152
              Q A+   +     DI A YKELGF
Sbjct: 119 TAGQQALRNIMATIIADIDATYKELGF 145


Go to top
>prf|0612242A|myoglobin
          Length = 146

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 2   DFDAVLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAISAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 61  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 -GQTALRNVMGIIIADLEANYKELGFSG 146


Go to top
>pdb|1MYT|1.74| 1| 146|N|MYOGLOBIN (MET)                          
                       
          Length = 146

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 2   DFDAVLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAISAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 61  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 -GQTALRNVMGIIIADLEANYKELGFSG 146


Go to top
>pdb|2NX0_A|0.95| 1| 146|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 146

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 2   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V++++   D G 
Sbjct: 61  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMQEKAGLDAG- 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 -GQTALRNVMGIIIADLEANYKELGFSG 146


Go to top
>pdb|2NRL_A|0.91| 1| 146|N|MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: A 
                       
          Length = 146

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 2   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V++++   D G 
Sbjct: 61  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMQEKAGLDAG- 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 -GQTALRNVMGIIIADLEANYKELGFSG 146


Go to top
>prf|2711146H|myoglobin
          Length = 147

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|P02205|MYG_THUAL Myoglobin.
          Length = 147

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|Q7T044|MYG_CHARH Myoglobin.
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG VE D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLKKLGDLLKARGGHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAIIITDMEADYKELGFT 146


Go to top
>prf|2711146F|myoglobin
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>prf|2711146A|myoglobin
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|P68190|MYG_THUTO Myoglobin.
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|P68189|MYG_THUTH Myoglobin.
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|Q76G09|MYG_THUOB Myoglobin.
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HPET + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPETQKLFPKFAGI-AQADIAGNAAVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA ++PLA SHATKHKIP+   + ISEV+++V+ ++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMHEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFSG 147


Go to top
>sp|Q9DEP0|MYG_CRYAN Myoglobin.
          Length = 147

 Score =  120 bits (301), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 88/147 (59%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG VE D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+     I+EVI +V++++   D  A
Sbjct: 62  ATVLKKLGDLLKARGGHAALLKPLSSSHATKHKIPIINFTLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAIIITDMEADYKELGFT 146


Go to top
>prf|2311496A|myoglobin
          Length = 147

 Score =  120 bits (300), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG +E D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPMEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLNKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAIIITDMEADYKELGFT 146


Go to top
>sp|P87497|MYG_CHIRA Myoglobin.
          Length = 147

 Score =  120 bits (300), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG +E D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPMEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLNKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAIIITDMEADYKELGFT 146


Go to top
>sp|Q9DEN9|MYG_GOBGI Myoglobin.
          Length = 147

 Score =  120 bits (300), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 88/147 (59%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG VE D   HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPVEADYTTHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLNKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAVIIADMEADYKELGFT 146


Go to top
>sp|Q9DEN8|MYG_NOTCO Myoglobin.
          Length = 147

 Score =  119 bits (299), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG +E D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGPMEADYATHGGLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLNKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAVIIADMEADYKELGFT 146


Go to top
>sp|P02204|MYG_CYPCA Myoglobin.
          Length = 147

 Score =  119 bits (298), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 3/146 (2%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           ++VL  WG VE D  G G EVL  LFK HPET + F KF  + S E +  +  +K HG T
Sbjct: 5   ELVLKCWGGVEADFEGTGGEVLTRLFKQHPETQKLFPKFVGIASNE-LAGNAAVKAHGAT 63

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VL  LG +LK +G HAA ++PLA +HA  HKI +     I+EV+++V+ ++   D G   
Sbjct: 64  VLKKLGELLKARGDHAAILKPLATTHANTHKIALNNFRLITEVLVKVMAEKAGLDAG--G 121

Query: 129 QGAMSKALELFRNDIAAKYKELGFQG 154
           Q A+ + +++   DI   YKE+GF G
Sbjct: 122 QSALRRVMDVVIGDIDTYYKEIGFAG 147


Go to top
>prf|2711146B|myoglobin
          Length = 147

 Score =  118 bits (296), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HP+T + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPDTQKLFPKFAGI-AQADLAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HA+ ++P+A SHATKHKIP+   + ISEV+++V++++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHASILKPMANSHATKHKIPINNFKLISEVLVKVMQEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFTG 147


Go to top
>sp|Q9DGJ2|MYG_THUAA Myoglobin.
          Length = 147

 Score =  118 bits (296), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 90/148 (60%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HP+T + F KF  + ++ ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADYTTIGGLVLTRLFKEHPDTQKLFPKFAGI-AQADLAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HA+ ++P+A SHATKHKIP+   + ISEV+++V++++   D G 
Sbjct: 62  ATVLKKLGELLKAKGSHASILKPMANSHATKHKIPINNFKLISEVLVKVMQEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGIIIADLEANYKELGFTG 147


Go to top
>sp|Q9DEP1|MYG_PSEGE Myoglobin.
          Length = 147

 Score =  118 bits (296), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++ MVL  WG VE D A +G  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3   DFDMVLKCWGLVEADYATYGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D  A
Sbjct: 62  ATVLNKLGDLLKARGGHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQ 153
             Q A+   + +   D+ A YKELGF 
Sbjct: 120 AGQTALRNVMAVIIADMEADYKELGFT 146


Go to top
>sp|Q6VN46|MYG_DANRE Myoglobin.
          Length = 147

 Score =  117 bits (294), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 89/146 (60%), Gaps = 3/146 (2%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
            +VL  WG VE D A +G EVL  LFK +P+TL+ F KF  + S+ ++  S  +  HG T
Sbjct: 5   DLVLKCWGAVEADYAANGGEVLNRLFKEYPDTLKLFPKFSGI-SQGDLAGSPAVAAHGAT 63

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VL  LG +LK KG HAA ++PLA +HA  HK+ +     I+EV+++V+ ++   D  A  
Sbjct: 64  VLKKLGELLKAKGDHAALLKPLANTHANIHKVALNNFRLITEVLVKVMAEKAGLD--AAG 121

Query: 129 QGAMSKALELFRNDIAAKYKELGFQG 154
           QGA+ + ++    DI   YKE+GF G
Sbjct: 122 QGALRRVMDAVIGDIDGYYKEIGFAG 147


Go to top
>tr|Q90WH9|Q90WH9_HEMAM Myoglobin (Fragment).
          Length = 142

 Score =  117 bits (294), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 3/145 (2%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +VL  WG VE D A +G  VL  LF  HP+T + F KF  + ++ +M +   +  HG TV
Sbjct: 1   LVLKCWGPVEADYAAYGSLVLTRLFTEHPDTQKLFPKFAGI-AQGDMAADAGISAHGATV 59

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           L  LG +LK KG HAA ++PLA SHATKHKIP+     I+EVI +V+ ++   D  A  Q
Sbjct: 60  LRKLGELLKAKGSHAAILKPLANSHATKHKIPINNFRLITEVIGKVMGEKTGLD--AAGQ 117

Query: 130 GAMSKALELFRNDIAAKYKELGFQG 154
            A+   + +   D+ A YK LGF G
Sbjct: 118 QALRNVMAIVVADMEADYKLLGFTG 142


Go to top
>prf|1206204A|myoglobin
          Length = 148

 Score =  117 bits (293), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 1/149 (0%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +W  V ++W  VE ++   GQ +L+ LF+ +PE+ + F K KN KS  E+K + D+K  
Sbjct: 1   ABWDKVNSVWSAVEQNITAIGQNILLRLFEQYPESEDYFPKLKN-KSLGELKDTADIKAQ 59

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
             TVL ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  
Sbjct: 60  ADTVLRALGNIVKKKGDHSQPVKALAATHITTHKIPPHYFTKITTIAVGVLSEMYPSEMN 119

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A AQ A S A +   +DI  +YK   FQG
Sbjct: 120 AQAQAAFSGAFKNICSDIEKEYKAANFQG 148


Go to top
>sp|P14398|MYG_GALJA Myoglobin.
          Length = 149

 Score =  117 bits (292), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 1/149 (0%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +W  V ++W  VE ++   GQ +L+ LF+ +PE+ + F K KN KS  E+K + D+K  
Sbjct: 2   ABWDKVNSVWSAVEQNITAIGQNILLRLFEQYPESEDYFPKLKN-KSLGELKDTADIKAQ 60

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
             TVL ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  
Sbjct: 61  ADTVLRALGNIVKKKGDHSQPVKALAATHITTHKIPPHYFTKITTIAVGVLSEMYPSEMN 120

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A AQ A S A +   +DI  +YK   FQG
Sbjct: 121 AQAQAAFSGAFKNICSDIEKEYKAANFQG 149


Go to top
>sp|P14397|MYG_GALGA Myoglobin.
          Length = 149

 Score =  115 bits (289), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 86/149 (57%), Gaps = 1/149 (0%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +W  V ++W  +E ++   GQ +L+ LF+ +PE+   F K KN KS  E+K + D+K  
Sbjct: 2   ADWDKVNSVWSAMEANITAVGQNILLRLFEQYPESQSYFPKLKN-KSLGELKDTADIKAQ 60

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
             TVL ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  
Sbjct: 61  ADTVLKALGNIVKKKGNHSQPVKALAATHITTHKIPPHYFTKITTIAVGVLSEMYPSEMN 120

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A AQ A S A +   +DI  +YK   FQG
Sbjct: 121 AQAQEAFSGAFKSICSDIEKEYKAANFQG 149


Go to top
>prf|0710196A|myoglobin
          Length = 148

 Score =  115 bits (289), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 86/149 (57%), Gaps = 1/149 (0%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            +W  V ++W  +E ++   GQ +L+ LF+ +PE+   F K KN KS  E+K + D+K  
Sbjct: 1   ADWDKVNSVWSAMEANITAVGQNILLRLFEQYPESQSYFPKLKN-KSLGELKDTADIKAQ 59

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
             TVL ALG I+KKKG H+  ++ LA +H T HKIP  Y   I+ + + VL + Y  +  
Sbjct: 60  ADTVLKALGNIVKKKGNHSQPVKALAATHITTHKIPPHYFTKITTIAVGVLSEMYPSEMN 119

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A AQ A S A +   +DI  +YK   FQG
Sbjct: 120 AQAQEAFSGAFKSICSDIEKEYKAANFQG 148


Go to top
>prf|3122279A|myoglobin
          Length = 147

 Score =  115 bits (289), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 87/148 (58%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HP+T + F KF  + +  ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADFNTVGGMVLARLFKDHPDTQKLFPKFAGI-AAGDLAGNAAVAAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA I+PLA SHATKHKIP+   + I+E ++ V++++   D  A
Sbjct: 62  GTVLKKLGELLKAKGNHAAIIKPLANSHATKHKIPINNFKLITEALVHVMQEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 AGQTALRNVMGIVIADLEANYKELGFTG 147


Go to top
>sp|Q6I7B0|MYG_AUXRO Myoglobin.
          Length = 147

 Score =  115 bits (289), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 87/148 (58%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LFK HP+T + F KF  + +  ++  +  +  HG
Sbjct: 3   DFDAVLKCWGPVEADFNTVGGMVLARLFKDHPDTQKLFPKFAGI-AAGDLAGNAAVAAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA I+PLA SHATKHKIP+   + I+E ++ V++++   D  A
Sbjct: 62  GTVLKKLGELLKAKGNHAAIIKPLANSHATKHKIPINNFKLITEALVHVMQEKAGLD--A 119

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 120 AGQTALRNVMGIVIADLEANYKELGFTG 147


Go to top
>tr|P79846|P79846_9PERC Myoglobin (Fragment).
          Length = 141

 Score =  115 bits (288), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 85/143 (59%), Gaps = 3/143 (2%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           VL  WG +E D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG TVL
Sbjct: 1   VLKCWGPMEADYATHGGLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHGATVL 59

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
             LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++   D G   Q 
Sbjct: 60  NKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEKAGVDAG--GQT 117

Query: 131 AMSKALELFRNDIAAKYKELGFQ 153
            +   + +   D+ A YKELGF 
Sbjct: 118 GLRNVMAVIIADMEAAYKELGFT 140


Go to top
>prf|2711146E|myoglobin
          Length = 147

 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LF  HP+T + F KF  +    +M  +  +  HG
Sbjct: 3   DFDAVLKFWGPVEADYDKIGNMVLTRLFTEHPDTQKLFPKFAGI-GLGDMAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  L  +LK KG HA  I+PLA SHATKHKI +   + I+E+I++V++++   D G 
Sbjct: 62  ATVLKKLAEVLKAKGNHAGIIKPLANSHATKHKIAINNFKLITEIIVKVMQEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +F  D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGVFIADMDANYKELGFSG 147


Go to top
>sp|Q9DGI9|MYG_SCOJP Myoglobin.
          Length = 147

 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 3/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           ++  VL  WG VE D    G  VL  LF  HP+T + F KF  +    +M  +  +  HG
Sbjct: 3   DFDAVLKFWGPVEADYDKIGNMVLTRLFTEHPDTQKLFPKFAGI-GLGDMAGNAAISAHG 61

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  L  +LK KG HA  I+PLA SHATKHKI +   + I+E+I++V++++   D G 
Sbjct: 62  ATVLKKLAEVLKAKGNHAGIIKPLANSHATKHKIAINNFKLITEIIVKVMQEKAGLDAG- 120

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +F  D+ A YKELGF G
Sbjct: 121 -GQTALRNVMGVFIADMDANYKELGFSG 147


Go to top
>tr|A1YQ89|A1YQ89_GADMO Myoglobin.
          Length = 145

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 85/149 (57%), Gaps = 5/149 (3%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            ++ +VL  WG VE D   HG  VL  LF  HP+T + F K   +    E+ +S  +  H
Sbjct: 2   ADYDLVLRCWGPVEADYNTHGGLVLTRLFTEHPDTQKLFPKLAGVG---ELAASVAVASH 58

Query: 66  GCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125
           G TVL  LG +LK +G HAA ++PLA SHA  HKIP+   + I+EVI + + ++   D  
Sbjct: 59  GATVLKKLGELLKTRGDHAALLKPLATSHANVHKIPINNFKLITEVIAKHMAEKAGLD-- 116

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A  Q A+ K + +   D+ A YKELGF G
Sbjct: 117 AAGQEALRKVMSVVIADMDATYKELGFSG 145


Go to top
>prf|2711146G|myoglobin
          Length = 146

 Score =  110 bits (274), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 82/148 (55%), Gaps = 4/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +   VL  WG VE D    G  VL  LFK HPET + F KF  +  +  +  +  +  HG
Sbjct: 3   DLDAVLKCWGAVEADFNTVGGLVLARLFKDHPETQKLFPKFAGITGD--IAGNAAVAAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA I+PLA SHA +HKIP+   + I+E +  VL ++   D  A
Sbjct: 61  ATVLKKLGELLKAKGNHAAIIKPLANSHAKQHKIPINNFKLITEALAHVLHEKAGLD--A 118

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 119 AGQTALRNVMGIVIADLEANYKELGFTG 146


Go to top
>sp|Q9DGI8|MYG_KATPE Myoglobin.
          Length = 146

 Score =  110 bits (274), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 82/148 (55%), Gaps = 4/148 (2%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           +   VL  WG VE D    G  VL  LFK HPET + F KF  +  +  +  +  +  HG
Sbjct: 3   DLDAVLKCWGAVEADFNTVGGLVLARLFKDHPETQKLFPKFAGITGD--IAGNAAVAAHG 60

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
            TVL  LG +LK KG HAA I+PLA SHA +HKIP+   + I+E +  VL ++   D  A
Sbjct: 61  ATVLKKLGELLKAKGNHAAIIKPLANSHAKQHKIPINNFKLITEALAHVLHEKAGLD--A 118

Query: 127 DAQGAMSKALELFRNDIAAKYKELGFQG 154
             Q A+   + +   D+ A YKELGF G
Sbjct: 119 AGQTALRNVMGIVIADLEANYKELGFTG 146


Go to top
>prf|670985A|myoglobin N term fragment
          Length = 60

 Score =  102 bits (255), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 46/59 (77%), Positives = 53/59 (89%)

Query: 3  LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
          LSD EWQ+VLNIW KVE D+AGHGQ++LI LFK HPETLEKFDKFK+LK+E EMK+SED
Sbjct: 2  LSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASED 60


Go to top
>tr|Q98963|Q98963_9PERC Myoglobin (Fragment).
          Length = 110

 Score =  100 bits (249), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 70/109 (64%), Gaps = 1/109 (0%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           VL  WG +E D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG TVL
Sbjct: 1   VLKCWGPMEADYATHGGLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHGATVL 59

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
             LG +LK +G HAA ++PL+ SHATKHKIP+   + I+EVI +V++++
Sbjct: 60  NKLGDLLKARGAHAALLKPLSSSHATKHKIPIINFKLIAEVIGKVMEEK 108


Go to top
>prf|3120322E|cytoglobin
          Length = 190

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD E +M+ + WG V  +    G  +LI  F   P   + F +F++++  EEM+ S  L
Sbjct: 30  LSDTEREMIRDAWGHVYKNCEDVGVSILIRFFVNFPSAKQYFSQFQDMEEPEEMERSSQL 89

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           + H C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++VL + 
Sbjct: 90  RHHACRVMNALNTVVENLHDPEKVSSVLAVVGRAHAVKHKVEPMYFKILSGVILEVLCED 149

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F AD Q   SK +      +   Y ++G+
Sbjct: 150 FPEFFTADVQLVWSKLMATVYWHVTGAYTDVGW 182


Go to top
>tr|Q575S6|Q575S6_TETNG Cytoglobin-2.
          Length = 190

 Score = 86.3 bits (212), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD E +M+ + WG V  +    G  +LI  F   P   + F +F++++  EEM+ S  L
Sbjct: 30  LSDTEREMIRDAWGHVYKNCEDVGVSILIRFFVNFPSAKQYFSQFQDMEEPEEMERSSQL 89

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           + H C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++VL + 
Sbjct: 90  RHHACRVMNALNTVVENLHDPEKVSSVLAVVGRAHAVKHKVEPMYFKILSGVILEVLCED 149

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F AD Q   SK +      +   Y ++G+
Sbjct: 150 FPEFFTADVQLVWSKLMATVYWHVTGAYTDVGW 182


Go to top
>tr|Q8AY74|Q8AY74_9PERC Truncated myoglobin.
          Length = 103

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 7  EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
          ++ MVL  WG VE D A HG  VL  LF  HPETL+ F KF  + ++ ++     +  HG
Sbjct: 3  DFDMVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AQGDLAGDAGVSAHG 61

Query: 67 CTVLTALGTILKKKGQHAAEIQPLAQSHATK 97
           TVL  LG +LK +G HAA  +PL+ SHAT 
Sbjct: 62 ATVLNKLGDLLKARGAHAALPKPLSSSHATP 92


Go to top
>prf|3024324C|eye-globin
          Length = 151

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 7/155 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M  S+ E Q     W K+  D   +G  VL+ +F  HP+T   F  FK + S EEMK S+
Sbjct: 1   MSFSEAEVQSARGAWEKMYVDAEDNGTAVLVRMFTEHPDTKSYFTHFKGMDSAEEMKQSD 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAE---IQPLAQSHATKHKIPVKYLEFISEVIIQVLK 117
            ++ HG  V TA+  +++      A    + PL Q HAT+ KI  K    I ++I+Q+++
Sbjct: 61  QVRGHGKRVFTAINDMVQHLDNTEAFLGILNPLGQKHATQLKIDPKNFRIICDIILQLME 120

Query: 118 KRYSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           ++    FG D + +  K        +   YKE G+
Sbjct: 121 EK----FGGDCKASFEKVTNEICTHLTNIYKEAGW 151


Go to top
>tr|Q5QRU6|Q5QRU6_CHICK Eye-globin.
          Length = 151

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 7/155 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M  S+ E Q     W K+  D   +G  VL+ +F  HP+T   F  FK + S EEMK S+
Sbjct: 1   MSFSEAEVQSARGAWEKMYVDAEDNGTAVLVRMFTEHPDTKSYFTHFKGMDSAEEMKQSD 60

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAE---IQPLAQSHATKHKIPVKYLEFISEVIIQVLK 117
            ++ HG  V TA+  +++      A    + PL Q HAT+ KI  K    I ++I+Q+++
Sbjct: 61  QVRGHGKRVFTAINDMVQHLDNTEAFLGILNPLGQKHATQLKIDPKNFRIICDIILQLME 120

Query: 118 KRYSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           ++    FG D + +  K        +   YKE G+
Sbjct: 121 EK----FGGDCKASFEKVTNEICTHLTNIYKEAGW 151


Go to top
>tr|Q8BN80|Q8BN80_MOUSE 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130009J07
           product:CYTOGLOBIN homolog.
          Length = 190

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+ LF   P   + F +F++++   EM+ S  L+KH
Sbjct: 22  AERKAVQATWARLYANCEDVGVAILVRLFVNFPSAKQYFSQFRHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEEFAN 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPVETQKAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>tr|O57410|O57410_CHAGU Mutant myoglobin.
          Length = 103

 Score = 83.6 bits (205), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 7  EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
          ++ MVL  WG VE D A HG  VL  LF  HPETL+ F KF  + +  ++     +  HG
Sbjct: 3  DFDMVLKCWGPVEADHATHGSLVLTRLFTEHPETLKLFPKFAGI-AHGDLAGDAGVSAHG 61

Query: 67 CTVLTALGTILKKKGQHAAEIQPLAQSHATK 97
           TVL  LG +LK +G HAA  +PL+ SHAT 
Sbjct: 62 ATVLNKLGDLLKARGAHAALPKPLSSSHATP 92


Go to top
>prf|2822293A|stellate cell activation-associated protein
          Length = 190

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>tr|Q541Y7|Q541Y7_HUMAN cDNA FLJ40738 fis, clone TKIDN2004185,
           weakly similar to GLOBIN (Cytoglobin, isoform CRA_b).
          Length = 190

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>sp|Q8WWM9|CYGB_HUMAN Cytoglobin (Histoglobin) (HGb) (Stellate cell
           activation-associated protein).
          Length = 190

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|2DC3_B|1.68| 2| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN:
           A, B; SYNONYM:
          Length = 193

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 25  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 84

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 85  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 144

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 145 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 174


Go to top
>pdb|2DC3_A|1.68| 2| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN:
           A, B; SYNONYM:
          Length = 193

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 25  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 84

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 85  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 144

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 145 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 174


Go to top
>pdb|1V5H_A|2.40| 1| 193|N|MOL_ID: 1; MOLECULE: CYTOGLOBIN; CHAIN:
           A; SYNONYM: HIS
          Length = 193

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 81/150 (54%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 25  AERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 84

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 85  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 144

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 145 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 174


Go to top
>tr|Q00M97|Q00M97_CANFA Cytoglobin.
          Length = 183

 Score = 82.8 bits (203), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 79/150 (52%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+  F   P   + F +FK++    EM+ S  L+KH
Sbjct: 15  AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMTEPLEMERSPQLRKH 74

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 75  ACRVMGALNTVVENLHDPEKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVIAEEFAN 134

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 135 DFPPETQRAWAKLRSLIYSHVTAAYKEVGW 164


Go to top
>tr|A9JIH5|A9JIH5_SPAJD Cytoglobin.
          Length = 190

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 15  WGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALG 74
           W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH C V+ AL 
Sbjct: 31  WARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEPLEMERSPQLRKHACRVMEALN 90

Query: 75  TI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGA 131
           T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ DF  + Q A
Sbjct: 91  TVVENLHDPDKVSSVLSLVGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRA 150

Query: 132 MSKALELFRNDIAAKYKELGF 152
            +K   L  + + A YKE+G+
Sbjct: 151 WAKLRGLIYSHVTAAYKEVGW 171


Go to top
>prf|2716209A|stellate cell activation-associated protein
          Length = 190

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 79/150 (52%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI+ V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILDVIAEEFAN 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPVETQKAWTKLRGLIYSHVTAAYKEVGW 171


Go to top
>sp|Q921A4|CYGB_RAT Cytoglobin (Histoglobin) (HGb) (Stellate cell
           activation-associated protein).
          Length = 190

 Score = 82.4 bits (202), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 79/150 (52%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI+ V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILDVIAEEFAN 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPVETQKAWTKLRGLIYSHVTAAYKEVGW 171


Go to top
>tr|Q546K1|Q546K1_MOUSE Cytoglobin (Activated spleen cDNA, RIKEN
           full-length enriched library, clone:F830209E03
           product:cytoglobin, full insert sequence) (Adult male
           aorta and vein cDNA, RIKEN full-length enriched library,
           clone:A530023M01 product:cytoglobin, full insert
           sequence).
          Length = 190

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+  F   P   + F +F++++   EM+ S  L+KH
Sbjct: 22  AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFRHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEEFAN 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPVETQKAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>sp|Q9CX80|CYGB_MOUSE Cytoglobin (Histoglobin) (HGb).
          Length = 190

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V   W ++  +    G  +L+  F   P   + F +F++++   EM+ S  L+KH
Sbjct: 22  AERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFRHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
            C V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEEFAN 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPVETQKAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>prf|3120322A|cytoglobin
          Length = 177

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  M+ + W KV  +    G  +L+ LF   P + + F +FK+++  EE++ S  L
Sbjct: 17  LTDKERVMIQDSWAKVYQNCDDAGVAILVRLFVNFPSSKQYFSQFKHIEDAEELEKSSQL 76

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA +HK+   Y + +S VI++VL + 
Sbjct: 77  RKHARRVMNAINTLVESLDNSDKVSSVLNAVGKAHAIRHKVDPVYFKILSGVILEVLGEA 136

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y     A+   A +  L +    I A Y+ELG+
Sbjct: 137 YPQVMTAEVASAWTNLLAILCCSIKAVYEELGW 169


Go to top
>sp|Q575T0|CYGB1_ORYLA Cytoglobin-1.
          Length = 177

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  M+ + W KV  +    G  +L+ LF   P + + F +FK+++  EE++ S  L
Sbjct: 17  LTDKERVMIQDSWAKVYQNCDDAGVAILVRLFVNFPSSKQYFSQFKHIEDAEELEKSSQL 76

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA +HK+   Y + +S VI++VL + 
Sbjct: 77  RKHARRVMNAINTLVESLDNSDKVSSVLNAVGKAHAIRHKVDPVYFKILSGVILEVLGEA 136

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y     A+   A +  L +    I A Y+ELG+
Sbjct: 137 YPQVMTAEVASAWTNLLAILCCSIKAVYEELGW 169


Go to top
>prf|3024324B|cytoglobin
          Length = 179

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 80/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +SD E +++   W +V  +    G  +LI  F   P   + F +FK++    EM+ S  L
Sbjct: 19  ISDAEKKVIQETWSRVYANCEDVGVSILIRFFVNFPSAKQYFSQFKHMDDTLEMERSLQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA KHK+   Y + ++ V+++V+ + 
Sbjct: 79  RKHAQRVMGAINTVVENLDDPEKVSSVLALVGKAHALKHKVEPVYFKKLTGVMLEVIAEA 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y  DF  +A GA +K   L    + A YKE G+
Sbjct: 139 YGNDFTPEAHGAWTKMRTLIYTHVTAAYKEAGW 171


Go to top
>tr|Q5QRU7|Q5QRU7_CHICK Cytoglobin.
          Length = 179

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 80/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +SD E +++   W +V  +    G  +LI  F   P   + F +FK++    EM+ S  L
Sbjct: 19  ISDAEKKVIQETWSRVYANCEDVGVSILIRFFVNFPSAKQYFSQFKHMDDTLEMERSLQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA KHK+   Y + ++ V+++V+ + 
Sbjct: 79  RKHAQRVMGAINTVVENLDDPEKVSSVLALVGKAHALKHKVEPVYFKKLTGVMLEVIAEA 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y  DF  +A GA +K   L    + A YKE G+
Sbjct: 139 YGNDFTPEAHGAWTKMRTLIYTHVTAAYKEAGW 171


Go to top
>prf|3120322D|cytoglobin
          Length = 179

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L++ E  M+ + W KV       G  +L+  F   P + + F  FK+++  EEM+ S  L
Sbjct: 19  LTEKEKVMIQDSWAKVFQSCDDAGVAILVRFFVNFPSSKQFFKDFKHMEEPEEMQQSVQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+TAL T+   L    + A+ ++ + ++HA +H +  KY + +S VI++VL + 
Sbjct: 79  RKHAHRVMTALNTLVESLDNADRVASVLKSVGRAHALRHNVDPKYFKILSGVILEVLGEA 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           ++    A+   A +K L      IAA YKE G+
Sbjct: 139 FTEIITAEVASAWTKLLANMCCGIAAVYKEAGW 171


Go to top
>tr|Q575S7|Q575S7_TETNG Cytoglobin-1.
          Length = 179

 Score = 79.7 bits (195), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 82/153 (53%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L++ E  M+ + W KV       G  +L+  F   P + + F  FK+++  EEM+ S  L
Sbjct: 19  LTEKEKVMIQDSWAKVFQSCDDAGVAILVRFFVNFPSSKQFFKDFKHMEEPEEMQQSVQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+TAL T+   L    + A+ ++ + ++HA +H +  KY + +S VI++VL + 
Sbjct: 79  RKHAHRVMTALNTLVESLDNADRVASVLKSVGRAHALRHNVDPKYFKILSGVILEVLGEA 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           ++    A+   A +K L      IAA YKE G+
Sbjct: 139 FTEIITAEVASAWTKLLANMCCGIAAVYKEAGW 171


Go to top
>tr|A9JIH3|A9JIH3_SPAGA Cytoglobin.
          Length = 190

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 3/141 (2%)

Query: 15  WGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALG 74
           W ++  +       +L+  F   P   + F +FK ++   EM+ S  L+KH C V+ AL 
Sbjct: 31  WARLYANCEDVRVAILVRFFVNFPSAKQYFSQFKRMEEPLEMERSPQLRKHACRVMGALN 90

Query: 75  TI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGA 131
           T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ DF  + Q A
Sbjct: 91  TVVENLHDPDKVSSVLSLVGKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRA 150

Query: 132 MSKALELFRNDIAAKYKELGF 152
            +K   L  + + A YKE+G+
Sbjct: 151 WAKLRGLIYSHVTAAYKEVGW 171


Go to top
>tr|Q66IV7|Q66IV7_XENLA MGC84306 protein (Cytoglobin).
          Length = 179

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 80/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +++ E  ++   W +V  +    G  +LI  F   P   + F +FK+++   EM+ S  L
Sbjct: 19  ITESERGVIKETWARVYANCEDVGVSILIRFFVNFPSAKQHFSQFKHMEDPLEMEGSVQL 78

Query: 63  KKHGCTVLTALGTILKKKGQH---AAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KHG  V+ A+ ++++  G        +  + +SHA KHK+   Y + ++ V+++V  + 
Sbjct: 79  RKHGRRVMGAVNSVVENLGDPEKVTTVLSIVGKSHALKHKVEPVYFKILTGVMLEVFAEE 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y+ DF  D Q   +K   L  + + + YKE+G+
Sbjct: 139 YAKDFTPDVQLVWNKLRSLIYSHVQSAYKEVGW 171


Go to top
>tr|Q4S9K1|Q4S9K1_TETNG Chromosome undetermined SCAF14696, whole
           genome shotgun sequence. (Fragment).
          Length = 174

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 81/153 (52%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L++ E   + + W KV       G  +L+  F   P + + F  FK+++  EEM+ S  L
Sbjct: 19  LTEKEKVRIQDSWAKVFQSCDDAGVAILVRFFVNFPSSKQFFKDFKHMEEPEEMQQSVQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+TAL T+   L    + A+ ++ + ++HA KH +  KY + +S VI++VL + 
Sbjct: 79  RKHAHRVMTALNTLVESLNNADRVASVLKSVGRAHALKHNVDPKYFKILSGVILEVLGEA 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           ++    A+   A +K L      IAA YKE G+
Sbjct: 139 FTEIITAEVASAWTKLLANMCCGIAAVYKEAGW 171


Go to top
>pdb|1UX9_B|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1UX9_A|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1UT0_B|2.1 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1UT0_A|2.1 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1URY_B|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1URY_A|2.4 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1URV_B|2.0 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1URV_A|2.0 | 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNONYM:
           HISTOGLOBIN,
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1UMO_B|2.59| 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNOYM:
           HISTOGLOBIN, H
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>pdb|1UMO_A|2.59| 2| 190|M|MOL_ID: 1; MOLECULE: CYTOGLOBIN; SYNOYM:
           HISTOGLOBIN, H
          Length = 190

 Score = 77.4 bits (189), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 3/150 (2%)

Query: 6   GEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKH 65
            E + V  +W ++  +    G  +L+  F   P   + F +FK+++   EM+ S  L+KH
Sbjct: 22  AERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKH 81

Query: 66  GCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
              V+ AL T+   L    + ++ +  + ++HA KHK+   Y + +S VI++V+ + ++ 
Sbjct: 82  ASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAS 141

Query: 123 DFGADAQGAMSKALELFRNDIAAKYKELGF 152
           DF  + Q A +K   L  + + A YKE+G+
Sbjct: 142 DFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171


Go to top
>tr|A6MHQ7|A6MHQ7_IGUIG Cytoglobin-1.
          Length = 196

 Score = 77.0 bits (188), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 82/154 (53%), Gaps = 4/154 (2%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +SD E +++   W +V  +    G  +LI  F   P     F +FK+++   EM+ S  L
Sbjct: 19  MSDAEKKVIQETWNRVYANCEDVGVSILIRFFVNFPSAKHYFSQFKHMEDPLEMERSLQL 78

Query: 63  KKHGCTVLTALGTILKK--KGQHAAEIQPLA-QSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ ++++     +  A +  L  ++HA KHK+   Y + ++ V+++VL + 
Sbjct: 79  RKHARRVMGAINSVVENIYDSEKVASVLALVGKAHAVKHKVEPVYFQILTGVMLEVLAEE 138

Query: 120 YSGDFGA-DAQGAMSKALELFRNDIAAKYKELGF 152
           Y+ +F + + Q A +K   L    + A YKE+G+
Sbjct: 139 YTNEFTSPEVQRAWAKMKNLICTHVTAAYKEVGW 172


Go to top
>prf|3120322B|cytoglobin
          Length = 194

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 79/153 (51%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD E +++ + WG V  +    G  VLI  F   P   + F +F++++  EEM+ S  L
Sbjct: 34  LSDAEMEIIQHTWGHVYKNCEDVGVSVLIRFFVNFPSAKQYFSQFQDMQDPEEMEKSSQL 93

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           ++H   V+ A+ T+   L+   + ++ +  + ++HA KHK+   Y +  S V++ VL + 
Sbjct: 94  RQHARRVMNAINTVVENLQDPEKVSSVLALVGKAHAVKHKVEPIYFKIXSGVMLSVLSED 153

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F A+ Q   +K +      +   Y E+G+
Sbjct: 154 FPEFFTAEVQLVWTKLMAAVYWHVTGAYTEVGW 186


Go to top
>sp|Q575S9|CYGB2_ORYLA Cytoglobin-2.
          Length = 179

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 79/153 (51%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSD E +++ + WG V  +    G  VLI  F   P   + F +F++++  EEM+ S  L
Sbjct: 19  LSDAEMEIIQHTWGHVYKNCEDVGVSVLIRFFVNFPSAKQYFSQFQDMQDPEEMEKSSQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           ++H   V+ A+ T+   L+   + ++ +  + ++HA KHK+   Y +  S V++ VL + 
Sbjct: 79  RQHARRVMNAINTVVENLQDPEKVSSVLALVGKAHAVKHKVEPIYFKIXSGVMLSVLSED 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F A+ Q   +K +      +   Y E+G+
Sbjct: 139 FPEFFTAEVQLVWTKLMAAVYWHVTGAYTEVGW 171


Go to top
>tr|Q6DEW1|Q6DEW1_XENTR Cytoglobin.
          Length = 179

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 79/153 (51%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +++ E  ++   W +V  +    G  +LI  F   P   + F +FK+++   EM+ S  L
Sbjct: 19  ITESERGVIKETWARVYANCEDVGVSILIRFFVNFPSAKQHFSQFKHMEDPLEMEGSVQL 78

Query: 63  KKHGCTVLTALGTILKKKGQH---AAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ ++++  G        +  + +SHA KHK+   Y + ++ V+++V+ + 
Sbjct: 79  RKHARRVMGAVNSVVENLGDPEKITTVLSIVGKSHALKHKVDPVYFKILTGVMLEVIAEE 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           Y+ DF  D Q A +K      + + + YKE G+
Sbjct: 139 YAKDFTPDVQLAWNKLRSHLYSHVLSAYKEAGW 171


Go to top
>tr|A6MHQ8|A6MHQ8_IGUIG Cytoglobin-2.
          Length = 193

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 79/151 (52%), Gaps = 4/151 (2%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           +SD E +++   W +V  +    G  +LI  F   P     F +FK+++   EM+ S  L
Sbjct: 19  MSDAEKKVIQETWNRVYANCEDVGVSILIRFFVNFPSAKHYFSQFKHMEDPLEMERSLQL 78

Query: 63  KKHGCTVLTALGTILKK--KGQHAAEIQPLA-QSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ ++++     +  A +  L  ++HA KHK+   Y + ++ V+++VL + 
Sbjct: 79  RKHARRVMGAINSVVENIYDSEKVASVLALVGKAHAVKHKVEPVYFQILTGVMLEVLAEE 138

Query: 120 YSGDFGA-DAQGAMSKALELFRNDIAAKYKE 149
           Y+ +F + + Q A +K   L    + A YKE
Sbjct: 139 YTNEFTSPEVQRAWAKMKNLICTHVTAAYKE 169


Go to top
>tr|A4IGG7|A4IGG7_DANRE Cygb2 protein.
          Length = 179

 Score = 72.4 bits (176), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 78/153 (50%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  ++ + W +V       G  +LI  F   P   + F +F++++  EEM+ S  L
Sbjct: 19  LTDVERGIIKDTWARVYASCEDVGVTILIRFFVNFPSAKQYFSQFQDMEDPEEMEKSSQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA K+K+   Y + +S VI+++L + 
Sbjct: 79  RKHARRVMNAINTVVENLHDPEKVSSVLVLVGKAHAFKYKVEPVYFKILSGVILEILAEE 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F  + Q + SK +      I   Y E+G+
Sbjct: 139 FGECFTPEVQTSWSKLMAALYWHITGAYTEVGW 171


Go to top
>prf|1404348A|zeta globin
          Length = 142

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  MV++IWGK+       G E L  LF ++P+T   F  F      +  + S 
Sbjct: 1   MSLTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHF------DLHEGSP 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V  A+G  +K     A  +  L++ HA   ++ PV + +F+S  ++  L  R
Sbjct: 55  QLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNF-KFLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
              DF ADA  A  K L +  + +  KY+
Sbjct: 114 LPADFTADAHAAWDKFLSIVSSVLTEKYR 142


Go to top
>sp|P13787|HBAZ_HORSE Hemoglobin subunit zeta (Hemoglobin zeta
           chain) (Zeta-globin).
          Length = 142

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  MV++IWGK+       G E L  LF ++P+T   F  F      +  + S 
Sbjct: 1   MSLTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHF------DLHEGSP 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V  A+G  +K     A  +  L++ HA   ++ PV + +F+S  ++  L  R
Sbjct: 55  QLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNF-KFLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
              DF ADA  A  K L +  + +  KY+
Sbjct: 114 LPADFTADAHAAWDKFLSIVSSVLTEKYR 142


Go to top
>prf|3120322C|cytoglobin
          Length = 179

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 78/153 (50%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  ++ + W +V       G  +LI  F   P   + F +F++++  EEM+ S  L
Sbjct: 19  LTDVERGIIKDTWARVYASCEDVGVTILIRFFVNFPSAKQYFSQFQDMEDPEEMEKSSQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA K+K+   Y + +S VI+++L + 
Sbjct: 79  RKHARRVMNAINTVVENLHDPEKVSSVLVLVGKAHAFKYKVEPIYFKILSGVILEILAEE 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F  + Q + SK +      I   Y E+G+
Sbjct: 139 FGECFTPEVQTSWSKLMAALYWHITGAYTEVGW 171


Go to top
>sp|Q575S8|CYGB2_DANRE Cytoglobin-2.
          Length = 179

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 78/153 (50%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  ++ + W +V       G  +LI  F   P   + F +F++++  EEM+ S  L
Sbjct: 19  LTDVERGIIKDTWARVYASCEDVGVTILIRFFVNFPSAKQYFSQFQDMEDPEEMEKSSQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    + ++ +  + ++HA K+K+   Y + +S VI+++L + 
Sbjct: 79  RKHARRVMNAINTVVENLHDPEKVSSVLVLVGKAHAFKYKVEPIYFKILSGVILEILAEE 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +   F  + Q + SK +      I   Y E+G+
Sbjct: 139 FGECFTPEVQTSWSKLMAALYWHITGAYTEVGW 171


Go to top
>tr|Q4RLF0|Q4RLF0_TETNG Chromosome undetermined SCAF15021, whole
           genome shotgun sequence. (Fragment).
          Length = 132

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 68/130 (52%), Gaps = 3/130 (2%)

Query: 26  GQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTI---LKKKGQ 82
           G  +L+  F   P   + F +F++++  EEM+ S  L+ H C V+ AL T+   L    +
Sbjct: 1   GCLLLLRFFVNFPSAKQYFSQFQDMEEPEEMERSSQLRHHACRVMNALNTVVENLHDPEK 60

Query: 83  HAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRND 142
            ++ +  + ++HA KHK+   Y + +S VI++VL + +   F AD Q   SK +      
Sbjct: 61  VSSVLAVVGRAHAVKHKVEPMYFKILSGVILEVLCEDFPEFFTADVQLVWSKLMATVYWH 120

Query: 143 IAAKYKELGF 152
           +   Y ++G+
Sbjct: 121 VTGAYTDVGW 130


Go to top
>tr|B0BL37|B0BL37_CARAU Cytoglobin 1 (Fragment).
          Length = 118

 Score = 69.3 bits (168), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 3/118 (2%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           ++ + W  V  +    G  VLI  F   P   + FD+F++++  EE+K S  LKKH   V
Sbjct: 1   VIQDTWRPVYENRENAGVAVLIRFFSNFPSAKQYFDQFRDIQDPEELKQSVQLKKHALRV 60

Query: 70  LTALGTILK--KKGQHAAEI-QPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDF 124
           +TAL T+++  + G     I Q + +SHA KHK+   Y + ++ VI++VL + +   F
Sbjct: 61  MTALNTMVENLRDGDKLNTIFQQMGKSHALKHKVDPLYFKILAGVILEVLVEAFPQCF 118


Go to top
>prf|2019265B|hemoglobin
          Length = 146

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ +IWGKV  ++A  G E L  L   +P T   F  F NL S   +  + ++K HG  
Sbjct: 9   QLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAISGNPNVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +  + + ++++ VL   +  DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKGTFAQLSELHCNKLHVDPENFKLLGDILVIVLAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|Q7LZB9|HBB_STROE Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ +IWGKV  ++A  G E L  L   +P T   F  F NL S   +  + ++K HG  
Sbjct: 9   QLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAISGNPNVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +  + + ++++ VL   +  DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKGTFAQLSELHCNKLHVDPENFKLLGDILVIVLAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|Q8UUR3|CYGB1_DANRE Cytoglobin-1.
          Length = 174

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 74/149 (49%), Gaps = 4/149 (2%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           ++ + W  V  +    G  VL+  F   P   + F+ F+ L+   EM+ +  LK+HG  V
Sbjct: 23  VIQDTWKPVYAERDNAGVAVLVRFFTNFPSAKQYFEHFRELQDPAEMQQNAQLKEHGQRV 82

Query: 70  LTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG- 125
           L AL T+   L+   +       + +SHA +HK+   Y + ++ VI++VL + +   F  
Sbjct: 83  LNALNTLVENLRDADKLNTIFNQMGKSHALRHKVDPVYFKILAGVILEVLVEAFPQCFSP 142

Query: 126 ADAQGAMSKALELFRNDIAAKYKELGFQG 154
           A+ Q + SK + +    +   Y E+G++ 
Sbjct: 143 AEVQSSWSKLMGILYWQMNRVYAEVGWEN 171


Go to top
>tr|A9P2Q8|A9P2Q8_DISMA Myoglobin (Fragment).
          Length = 98

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 3/100 (3%)

Query: 44  FDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVK 103
           F KF  + +  ++     +  HG TVL  LG +LK +G HAA ++PL+ SHATKHKIP+ 
Sbjct: 1   FPKFAGI-AHGDLAGDAGVSAHGATVLKKLGDLLKARGAHAALLKPLSSSHATKHKIPII 59

Query: 104 YLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDI 143
             + I+EVI +V++++   D  A  Q A+   + +   D+
Sbjct: 60  NFKLIAEVIGKVMEEKAGLD--AAGQTALRNVMAVIIADM 97


Go to top
>prf|1713377A|hemoglobin
          Length = 146

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ +IWGKV  ++A  G E L  L   +P T   F  F NL S   +  + ++K HG  
Sbjct: 9   QLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ +L   +  DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P11342|HBB_COLLI Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ +IWGKV  ++A  G E L  L   +P T   F  F NL S   +  + ++K HG  
Sbjct: 9   QLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ +L   +  DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0903200B|hemoglobin beta
          Length = 146

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTERFFSSFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02120|HBB_ANSSE Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTERFFSSFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P07036|HBB_CHLME Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAISGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P80216|HBB_APTFO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   + ++  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPAAVLANPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  D 
Sbjct: 67  VLTSFGDAVKNMDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAAQKLVRVVAHALARKY 145


Go to top
>tr|A2V8C2|A2V8C2_LAMJA Hemoglobin 4.
          Length = 159

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 72/137 (52%), Gaps = 3/137 (2%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
            SD E + + + W  V  +      E+LI  F  +P   + F KFK+L SEE++K S  +
Sbjct: 12  FSDDEKKAIKDSWSGVYSEYESTSSEILIKFFVDNPSAQDFFPKFKDLDSEEKLKGSTAV 71

Query: 63  KKHGCTVLTALGT---ILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           + H   ++ A+     +L +  ++A +++ L++ HA +  +  K+ + ++EVI+  + ++
Sbjct: 72  RWHAERIINAVNDAIWLLDEPEKNAKKLKELSEKHAVQLNVDAKFFKVLAEVILDKVAEK 131

Query: 120 YSGDFGADAQGAMSKAL 136
             G F   A+ A  K L
Sbjct: 132 NDGSFSDSARSAWEKLL 148


Go to top
>prf|1408161B|hemoglobin beta
          Length = 146

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D+
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDS 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P08261|HBB_LARRI Hemoglobin subunit beta/beta' (Hemoglobin
           beta/beta' chain) (Beta/beta'-globin).
          Length = 146

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D+
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDS 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P22742|HBB_FRAPO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 66.6 bits (161), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|2704324F|Hb
          Length = 146

 Score = 66.6 bits (161), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ N+WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITNLWGKV--NVAESGAEALARLLIPYPWTQRFFASFGNLFSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>tr|Q802S6|Q802S6_ONCMY Cytoglobin.
          Length = 177

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 76/153 (49%), Gaps = 3/153 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L D E +M+ + W KV  +    G  +LI LF   P + + F +F+ ++   E++ S  L
Sbjct: 19  LCDSEREMIKDTWAKVYQNCDDVGVAILIRLFVNFPSSKQYFSQFQQVEDPGELERSAQL 78

Query: 63  KKHGCTVLTALGTI---LKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           +KH   V+ A+ T+   L    +  + ++ + ++HA +H +   Y + +  VI++VL   
Sbjct: 79  RKHSRRVMNAINTLVENLHDGDKMVSVLKLVGKAHALRHNVEPVYFKILCGVILEVLVAD 138

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYKELGF 152
           +      +   A +K L+     +   Y+E+G+
Sbjct: 139 FPDYITPEVAVAWTKLLDAIYWHVKGVYEEVGW 171


Go to top
>tr|Q3KQ67|Q3KQ67_XENLA MGC130918 protein.
          Length = 142

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L++ E   V+ ++ K+    +  G E L  LF ++P+T   F  F      +    S 
Sbjct: 1   MTLTESEKAAVIALFEKISSSYSSIGAEALERLFLSYPQTNTYFSHF------DLSHGSS 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL  HG  V+TALG   KK     A +  L+  HA   ++     + +S  I + L   Y
Sbjct: 55  DLTTHGGKVMTALGKAAKKIDDLDAALSALSDLHAFNLRVDPGNFKLLSHTIQETLAIHY 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
           S DFGA  Q A  K L      + +KY+
Sbjct: 115 SSDFGASTQTAFDKFLTEITAVLTSKYR 142


Go to top
>prf|0809271C|hemoglobin Abeta
          Length = 146

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P68945|HBB_CYGOL Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P68944|HBB_BRACA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>tr|B0LCA7|B0LCA7_DISEL Myoglobin (Fragment).
          Length = 98

 Score = 66.2 bits (160), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 44  FDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVK 103
           F KF  + +  ++     +  HG TVL  LG +LK +G H A ++PL+ SHATKHKIP+ 
Sbjct: 1   FPKFAGI-AHGDLAGDAGVSAHGATVLKKLGDLLKARGAHTALLKPLSSSHATKHKIPII 59

Query: 104 YLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDI 143
             + I+EVI +V++++   D  A  Q A+   + +   D+
Sbjct: 60  NFKLIAEVIGKVMEEKAGLD--AAGQTALRNVMAVIIADM 97


Go to top
>prf|1603375A|beta globin
          Length = 147

 Score = 66.2 bits (160), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPDC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>sp|P14260|HBB_CAIMO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 66.2 bits (160), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPDC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>prf|0703209A|globin alpha
          Length = 146

 Score = 65.9 bits (159), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0502223B|hemoglobin beta
          Length = 146

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E  +V  +WGKV+  +   G E L  L   +P T   FD F +L S + +  +  +
Sbjct: 3   LTAEEKALVTGLWGKVK--VEEFGGEALGRLLVVYPWTQRFFDSFGDLSSADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL ++G  +K           L++ H  K  +  +    +  V++ VL + +  
Sbjct: 61  KAHGAKVLQSMGDGIKNLDNLKGTFSKLSELHCDKLHVDPENFRLLGNVLVCVLARHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +AAKY
Sbjct: 121 DFTPAAQAAFQKVVAGVANALAAKY 145


Go to top
>sp|P02059|HBB_ERIEU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E  +V  +WGKV+  +   G E L  L   +P T   FD F +L S + +  +  +
Sbjct: 3   LTAEEKALVTGLWGKVK--VEEFGGEALGRLLVVYPWTQRFFDSFGDLSSADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL ++G  +K           L++ H  K  +  +    +  V++ VL + +  
Sbjct: 61  KAHGAKVLQSMGDGIKNLDNLKGTFSKLSELHCDKLHVDPENFRLLGNVLVCVLARHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +AAKY
Sbjct: 121 DFTPAAQAAFQKVVAGVANALAAKY 145


Go to top
>prf|1603336A|hemoglobin beta
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  + +++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFTSFGNLSSASAVLGNPNVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAGHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P21668|HBB_PSIKR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  + +++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFTSFGNLSSASAVLGNPNVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAGHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|2119185C|hemoglobin
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0804242B|hemoglobin Abeta
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>tr|P84479|P84479_MELGA Hemoglobin beta chain.
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02113|HBB_PHACO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0908229B|hemoglobin beta
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P02122|HBB_AQUCH Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|754400A|hemoglobin beta
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS GE   V N+WGKV  ++   G E L  L   +P T   F+ F +L S   +  +  +
Sbjct: 3   LSGGEKSAVTNLWGKV--NINELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+ G  LK           L++ H  K  +  +    +  V+I VL + +S 
Sbjct: 61  KAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  + Q A  K +    + +  KY
Sbjct: 121 DFSPEVQAAWQKLVSGVAHALGHKY 145


Go to top
>sp|P02111|HBB_ORNAN Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS GE   V N+WGKV  ++   G E L  L   +P T   F+ F +L S   +  +  +
Sbjct: 3   LSGGEKSAVTNLWGKV--NINELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+ G  LK           L++ H  K  +  +    +  V+I VL + +S 
Sbjct: 61  KAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  + Q A  K +    + +  KY
Sbjct: 121 DFSPEVQAAWQKLVSGVAHALGHKY 145


Go to top
>prf|1601314B|hemoglobin beta
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAVIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      +    L++ H  K  +  +    + +++I VL   +S DF  +A
Sbjct: 67  VLTSFGEAVKNLDSIKSTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEA 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A +K +    + +A KY
Sbjct: 127 QQAWAKLVRAVAHALARKY 145


Go to top
>sp|P15165|HBB_APUAP Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAVIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      +    L++ H  K  +  +    + +++I VL   +S DF  +A
Sbjct: 67  VLTSFGEAVKNLDSIKSTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEA 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A +K +    + +A KY
Sbjct: 127 QQAWAKLVRAVAHALARKY 145


Go to top
>tr|Q38IW1|Q38IW1_XENTR Alpha globin larval-5 (Novel protein
           containing globin domain).
          Length = 142

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+ E   VL+IW K  G++   G E L  LF ++P+T   F  F +L S      S 
Sbjct: 1   MLLSEAEKAAVLSIWAKASGNVNALGAEALERLFLSYPQTKTYFSHF-DLSS-----GSH 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  VL A+G   +      A +  L+  HA   ++       +S  I   L   +
Sbjct: 55  DLQVHGGKVLGAIGEAAQHLDNLDAALSKLSDLHAYNLRVDPGNFRLLSHAIEVTLAVHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A AQ A  K L      + +KY+
Sbjct: 115 PDDFDATAQAAWDKFLAAISTVLTSKYR 142


Go to top
>tr|Q38IW2|Q38IW2_XENTR Alpha globin larval-4.
          Length = 142

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD E   V+++W K  G +   G E L  LF ++P+T   F  F +L S      S 
Sbjct: 1   MLLSDAEKAAVVSLWAKASGSVNALGAEALERLFLSYPQTKTYFSHF-DLSS-----GSH 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  VL A+G   K        +  L+  HA   ++       +S  I   L   +
Sbjct: 55  DLQVHGGKVLGAIGEATKHLDNLDEALSKLSDLHAYNLRVDPGNFRLLSHTIQVTLAAHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A AQ A  K L      + +KY+
Sbjct: 115 QADFDATAQAAWDKYLAAISTVLTSKYR 142


Go to top
>prf|753715A|hemoglobin AIIbeta
          Length = 146

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0904282A|globin beta
          Length = 147

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>pdb|1HBR_D|2.30| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHAIN:
           A, C; SYNONYM
          Length = 146

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1HBR_B|2.30| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN D; CHAIN:
           A, C; SYNONYM
          Length = 146

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02112|HBB_CHICK Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>prf|2704324E|Hb
          Length = 146

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFATFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0807239B|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0608224C|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1HV4_H|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-A
           CHAIN; CHAIN: A
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1HV4_F|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-A
           CHAIN; CHAIN: A
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1HV4_D|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-A
           CHAIN; CHAIN: A
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1HV4_B|2.80| 8| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA-A
           CHAIN; CHAIN: A
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1C40_B|2.30| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA
           CHAIN); CHAIN: A
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1A4F_B|2.0 | 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN; CHAIN:
           A, B          
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02118|HBB_ANSIN Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1306241C|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAVLGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIVVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P08851|HBB_ACCGE Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSATAVLGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIVVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|1512172C|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|1406208B|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|1304183C|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P68062|HBB_TRIOC Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P68063|HBB_GYPRU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P68061|HBB_AEGMO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFSPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>prf|1004263C|hemoglobin beta
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGDAVKNLDSIKNTFSQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02126|HBB_STUVU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGDAVKNLDSIKNTFSQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|2621286C|Hb
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1106157B|hemoglobin Abeta
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A+ K + +  + +A KY
Sbjct: 127 QAALQKLVRVVAHALARKY 145


Go to top
>sp|P82113|HBB_CATMA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02116|HBB_ARAAR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFGKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A+ K + +  + +A KY
Sbjct: 127 QAALQKLVRVVAHALARKY 145


Go to top
>prf|1409216B|hemoglobin beta
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAQCGGEALARLLIVYPWTQRFFSSFGNLSSPSAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNMDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWEKLVRVVAHALARKY 145


Go to top
>sp|P10058|HBB_EUDCR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAQCGGEALARLLIVYPWTQRFFSSFGNLSSPSAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNMDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWEKLVRVVAHALARKY 145


Go to top
>sp|P02114|HBB_ANAPL Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPEC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>prf|1509221B|hemoglobin beta
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGGEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDSIKGTFAQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1005216B|hemoglobin beta
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ ++WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITSLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P14524|HBB_TURME Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGGEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDSIKGTFAQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02121|HBB_PHORU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ ++WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITSLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|0903202C|hemoglobin beta
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02124|HBB_RHEAM Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1111200C|hemoglobin beta
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGGEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDSIKNTFSQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P07406|HBB_PASMO Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGGEALARLLIVYPWTQRFFASFGNLSSPTAVLGNPKVQAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + ++++ VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDSIKNTFSQLSELHCDKLHVDPENFRLLGDILVVVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|2806349C|hemoglobin
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ N+WGKV  + A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLISNLWGKV--NTAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNLDAIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1501221B|hemoglobin beta
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSATAITGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      A    L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKATFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVGAVAHALARKY 145


Go to top
>sp|P10782|HBB_PHACA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSATAITGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      A    L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGEAVKNLDNIKATFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVGAVAHALARKY 145


Go to top
>prf|1911215B|hemoglobin
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P30893|HBB_COTJA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>prf|1302222A|globin
          Length = 142

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  ++L++W K+       G E L  LF  +P+    F  F +L S      S 
Sbjct: 1   MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHF-DLHS-----GSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K      + +  L++ HA   ++ PV + +F+S  ++  L   
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNF-KFLSHCLLVTLASH 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF ADA  A  K L +    +  KY+
Sbjct: 114 FPADFTADAHAAWDKFLSIVSGVLTEKYR 142


Go to top
>sp|P13786|HBAZ_CAPHI Hemoglobin subunit zeta (Hemoglobin zeta
           chain) (Zeta-globin).
          Length = 142

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  ++L++W K+       G E L  LF  +P+    F  F +L S      S 
Sbjct: 1   MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHF-DLHS-----GSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K      + +  L++ HA   ++ PV + +F+S  ++  L   
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNF-KFLSHCLLVTLASH 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF ADA  A  K L +    +  KY+
Sbjct: 114 FPADFTADAHAAWDKFLSIVSGVLTEKYR 142


Go to top
>prf|1202212C|Hb beta
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCEKLHVDPENFRLLGDILIIVLAAHFAKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>sp|P07411|HBB_VULGR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAIIGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCEKLHVDPENFRLLGDILIIVLAAHFAKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +    + +A KY
Sbjct: 127 QAAWQKLVRAVAHALARKY 145


Go to top
>tr|Q575S4|Q575S4_XENLA Globin Y.
          Length = 156

 Score = 63.5 bits (153), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 3/148 (2%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  + + +  IW K+  +    G+ V+I LF  +P+T   F   KN+ + EEM+ +  +
Sbjct: 4   LTAADIENINEIWCKIYANPEESGKTVVIRLFTTYPQTKVYFKNLKNIATLEEMQVNPGI 63

Query: 63  KKHGCTVLTALGTILKKKGQH---AAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR 119
           + HG  V+ AL  +++        ++ +  LAQ H   HK+ V   + +  VI+ + K+ 
Sbjct: 64  RAHGKRVMGALNQVIQNLNDWEVVSSALTHLAQRHQDVHKVGVNNFQLLFLVILTIFKEA 123

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKY 147
              DF  +   +  K   +  N + + Y
Sbjct: 124 LGADFTPEHCKSWEKLFSITYNFLDSCY 151


Go to top
>prf|2807208B|Hb
          Length = 146

 Score = 63.5 bits (153), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QIITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIVVLAAHFSKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P84792|HBB_AYTFU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 63.5 bits (153), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 10  QIITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +S +F  + 
Sbjct: 68  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIVVLAAHFSKEFTPEC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 128 QAAWQKLVRVVAHALARKY 146


Go to top
>tr|B2KHZ6|B2KHZ6_RHIFE Hemoglobin, beta, epsilon 4 (Predicted).
          Length = 147

 Score = 63.2 bits (152), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           V N+W KV  ++AG   E+L  L   +P T   FD F NL SE  +  +  +K HG  VL
Sbjct: 12  VANLWAKVNVEVAG--GEILGRLLVVYPWTQRFFDSFGNLSSETAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
            + G  +K           L++ H  +  +  +  + +  +I+ VL  +++ +F    Q 
Sbjct: 70  NSFGNAVKHMDDLKGTFSHLSELHCDRLHVDPENFKLLGNMIVIVLATQFNREFTPQMQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K      N +A KY
Sbjct: 130 AWQKLTTAVANALAYKY 146


Go to top
>tr|Q6DES4|Q6DES4_XENTR Alpha globin larval-1.
          Length = 142

 Score = 63.2 bits (152), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M  SD E   V+++W K  G++   G E L  LF ++P+T   F  F +L S      S 
Sbjct: 1   MLFSDAEKAAVVSLWAKASGNVNALGAEALERLFLSYPQTKTYFSHF-DLGS-----GSH 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  VL A+G   K        +  L+  HA   ++       +S  I   L   +
Sbjct: 55  DLQVHGGKVLGAIGEATKHLDNLDEALSKLSDLHAYNLRVDPGNFRLLSHTIQVTLAAHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A AQ A  K L      + +KY+
Sbjct: 115 QADFDATAQAAWDKFLAAISTVLTSKYR 142


Go to top
>sp|P06347|HBAZ_PANTR Hemoglobin subunit zeta (Hemoglobin zeta
           chain) (Zeta-globin).
          Length = 142

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S 
Sbjct: 1   MSLTKTEGTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDNIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>tr|B1MT33|B1MT33_CALMO Zeta globin (Predicted).
          Length = 142

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF ++P+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSYPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K      A +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDNIGAALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>prf|2706289F|HBAZ protein
          Length = 142

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>tr|Q6IBF6|Q6IBF6_HUMAN HBZ protein (Hemoglobin, zeta).
          Length = 142

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>sp|P02008|HBAZ_HUMAN Hemoglobin subunit zeta (Hemoglobin zeta
           chain) (Zeta-globin) (HBAZ).
          Length = 142

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>prf|0408492B|hemoglobin beta
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>prf|0404172B|hemoglobin beta
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>pdb|2PGH_D|2.8 | 4| 146|N|HEMOGLOBIN (AQUOMET)                     
                       
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>pdb|2PGH_B|2.8 | 4| 146|N|HEMOGLOBIN (AQUOMET)                     
                       
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>pdb|1QPW_D|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOBIN
           (ALPHA SUBUNIT
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>pdb|1QPW_B|1.80| 4| 146|N|MOL_ID: 1; MOLECULE: PORICINE HEMOGLOBIN
           (ALPHA SUBUNIT
          Length = 146

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 3   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 61  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  D Q A  K +    N +A KY
Sbjct: 121 DFNPDVQAAFQKVVAGVANALAHKY 145


Go to top
>tr|Q38IW3|Q38IW3_XENTR Alpha globin larval-3.
          Length = 142

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LSD E   V+++W K  G +   G E L  LF ++P+T   F  F +L S      S 
Sbjct: 1   MLLSDAEKAAVVSLWAKASGSVNALGAEALERLFLSYPQTKTYFSHF-DLSS-----GSH 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  VL A+G   K        +  L+  HA   ++       +S  I   L   +
Sbjct: 55  DLQVHGGKVLGAIGEATKHLDNLDEALSKLSDLHAYNLRVDPGNFRLLSHTIQVTLAAHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             +F A AQ A  K L      + +KY+
Sbjct: 115 QAEFDATAQAAWDKYLAAISTVLTSKYR 142


Go to top
>prf|1110242C|globin alpha T5
          Length = 142

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M  S  E   + ++WGKV G     G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MTFSSAEKAAIASLWGKVSGHTDEIGAEALERLFLSYPQTKTYFSHF------DLSHGSK 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  V+ A+G            +  L+  HA K K+     + +S  I   L   +
Sbjct: 55  DLRSHGGKVVKAIGNAATHIDDIPHALSALSDLHAFKLKVDPGNFKLLSHAIQVTLAIHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             +F ADAQ A  K L +    + +KY+
Sbjct: 115 PAEFNADAQAAWDKFLAVVSAVLVSKYR 142


Go to top
>sp|P06638|HBA5_XENLA Hemoglobin subunit alpha-5 (Hemoglobin alpha-5
           chain) (Alpha-5-globin) (Alpha-T5).
          Length = 142

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M  S  E   + ++WGKV G     G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MTFSSAEKAAIASLWGKVSGHTDEIGAEALERLFLSYPQTKTYFSHF------DLSHGSK 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  V+ A+G            +  L+  HA K K+     + +S  I   L   +
Sbjct: 55  DLRSHGGKVVKAIGNAATHIDDIPHALSALSDLHAFKLKVDPGNFKLLSHAIQVTLAIHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             +F ADAQ A  K L +    + +KY+
Sbjct: 115 PAEFNADAQAAWDKFLAVVSAVLVSKYR 142


Go to top
>prf|0709218A|hemoglobin beta
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1FAW_D|3.09| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA
           SUBUNIT); CHAIN:
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>pdb|1FAW_B|3.09| 4| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN (ALPHA
           SUBUNIT); CHAIN:
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02117|HBB_ANSAN Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02093|HBB_ONDZI Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   +  +WGKV  D  G G E L  L   +P T   F+ F +L S   +  +  +
Sbjct: 3   LTDAEKAAISGLWGKVNAD--GVGAEALGRLLVVYPWTQRFFEHFGDLSSSSAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    LK           L++ H  K  +  +  + +  +I+ VL      
Sbjct: 61  KSHGKKVITAFADGLKHLDNLKGTFSALSELHCDKLHVDPENFKLLGNMIVIVLSHDLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  DAQ A  K +      +  KY
Sbjct: 121 DFTPDAQSAFQKVVTGVATALGHKY 145


Go to top
>sp|P02110|HBB_TACAC Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   V N+WG V  ++   G E L  L   +P T   F+ F +L S + +  +  +
Sbjct: 4   LSGSEKTAVTNLWGHV--NVNELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +S 
Sbjct: 62  KAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F  +AQ A  K +    + +A KY
Sbjct: 122 EFTPEAQAAWQKLVSGVSHALAHKY 146


Go to top
>prf|721937A|hemoglobin beta
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   V N+WG V  ++   G E L  L   +P T   F+ F +L S + +  +  +
Sbjct: 3   LSGSEKTAVTNLWGHV--NVNELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +S 
Sbjct: 61  KAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F  +AQ A  K +    + +A KY
Sbjct: 121 EFTPEAQAAWQKLVSGVSHALAHKY 145


Go to top
>sp|Q45XH3|HBE_BRATR Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 62/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           V ++WGKV  + AG   EVL  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  VASLWGKVNVEEAG--GEVLGRLLVVYPWTQRFFDNFGNLSSSSAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSFGDAVKHMDDLKGTFAHLSELHCDKLHVDPENFRLLGNVMVVVLASHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +    N +A KY
Sbjct: 130 AWQKLVGGVANALAHKY 146


Go to top
>prf|1010262B|hemoglobin beta
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  D  G   E L  L   +P T   F  F NL +   +  +  +  HG  
Sbjct: 9   QLITGLWGKVNVDECG--AEALARLLIVYPWTQRFFASFGNLATASAITGNAMVHAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +  + + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFKLLGDILIIVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWKKLVRVVAHALARKY 145


Go to top
>sp|P02125|HBB_CICCI Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  D  G   E L  L   +P T   F  F NL +   +  +  +  HG  
Sbjct: 9   QLITGLWGKVNVDECG--AEALARLLIVYPWTQRFFASFGNLATASAITGNAMVHAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +  + + +++I VL   +  DF  D 
Sbjct: 67  VLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFKLLGDILIIVLAAHFGKDFTPDC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWKKLVRVVAHALARKY 145


Go to top
>tr|A4ZQU5|A4ZQU5_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++WGK+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWGKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S   +  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCPLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|B2KHZ7|B2KHZ7_RHIFE Hemoglobin, epsilon 1 (Predicted).
          Length = 147

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           ++ N+WGK+  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  V
Sbjct: 11  VIANMWGKMNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSSSAIMGNPKVKAHGKKV 68

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           LT+ G  +K           L++ H  K  +  +    +  V++ +L   +  +F  + Q
Sbjct: 69  LTSFGDAIKNMDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIILASHFGKEFTPEVQ 128

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +    N +A KY
Sbjct: 129 AAWQKLVASVANALAHKY 146


Go to top
>tr|Q95233|Q95233_9PRIM Epsilon globin (Fragment).
          Length = 142

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 58/125 (46%), Gaps = 2/125 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +++N+WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  V
Sbjct: 11  IIMNLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDTFGNLSSASAIMGNPKVKAHGKKV 68

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           LT+ G  +K           L++ H  K  +  +  + +  VI+ +L   +  +F  D Q
Sbjct: 69  LTSFGEAVKNMDNLKGACAKLSELHCDKLHVDPENFKLLGNVIVIILATHFGKEFTPDVQ 128

Query: 130 GAMSK 134
            A  K
Sbjct: 129 AAWQK 133


Go to top
>prf|0912206B|hemoglobin beta
          Length = 146

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   +  +WGKV  D  G G E L  L   +P T   F+ F +L S   +  +  +
Sbjct: 3   LTDAEKAAISGLWGKVNAD--GVGAEALGRLLVVYPWTERFFEHFGDLSSSSAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    LK           L++ H  K  +  +  + +  +I+ VL      
Sbjct: 61  KSHGKKVITAFADGLKHLDNLKGTFSALSELHCDKLHVDPENFKLLGNMIVIVLSHDLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  DAQ A  K +      +  KY
Sbjct: 121 DFTPDAQSAFQKVVTGVATALGHKY 145


Go to top
>tr|A4ZQV4|A4ZQV4_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +V+++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIVMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|A4ZQT2|A4ZQT2_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFAAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|B0VX76|B0VX76_CALJA Zeta globin (Predicted).
          Length = 142

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L  LF ++P+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSYPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G   K      A +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAAKSIDNIGAALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>tr|A4ZQW2|A4ZQW2_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQTEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>sp|Q28338|HBE_CHEME Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +L++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ILSLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q 
Sbjct: 70  TSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>prf|0608224D|hemoglobin beta
          Length = 146

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLISGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02123|HBB_STRCA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLISGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   ++ +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02094|HBB_MESAU Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin) (Hemoglobin beta-major chain).
          Length = 147

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  +V  +WGKV  D    G E L  L   +P T   F+ F +L S   + ++  +
Sbjct: 4   LTDAEKALVTGLWGKVNADAV--GAEALGRLLVVYPWTQRFFEHFGDLSSASAVMNNPQV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +II VL      
Sbjct: 62  KAHGKKVIHSFADGLKHLDNLKGAFSSLSELHCDKLHVDPENFKLLGNMIIIVLSHDLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +A KY
Sbjct: 122 DFTPSAQSAFHKVVAGVANALAHKY 146


Go to top
>prf|0907199B|hemoglobin beta
          Length = 146

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFPKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P02115|HBB_ANAPP Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++  +WGKV  ++A  G E L  L   +P T   F  F NL S   +  +  ++ HG  
Sbjct: 9   QLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    + +++I VL   +  +F  + 
Sbjct: 67  VLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFPKEFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + +A KY
Sbjct: 127 QAAWQKLVRVVAHALARKY 145


Go to top
>sp|P08223|HBE_EULFU Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +L++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ILSLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDNFGNLSSASAILGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q 
Sbjct: 70  TSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>tr|A4ZQT5|A4ZQT5_PERMA Hemoglobin subunit zeta (Embryonic alpha
           globin).
          Length = 142

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>sp|Q28356|HBE_DAUMA Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           ++++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  IMSLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDNFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  V++ +L   +  +F  D Q 
Sbjct: 70  TSFGDAVKNMDNLKGAFAKLSELHCDKLHVDPENFRLLGNVMVIILATHFGKEFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>prf|2002385A|beta-like globin
          Length = 147

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 62/141 (43%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E   +  IWGKV  ++   G E L  L   +P T   FD F NL S   +  +  +K HG
Sbjct: 8   EKNAITTIWGKV--NVEETGGEALGRLLVVYPPTQRFFDSFGNLSSASAILGNPKVKAHG 65

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VLT+ G  +K           L++ H  K  +  +    +  V++ V+   ++ +F  
Sbjct: 66  KKVLTSFGDAVKNLDNLKGTFSKLSELHCDKLHVDPENFRLLGNVLVIVMAAHFNKEFTP 125

Query: 127 DAQGAMSKALELFRNDIAAKY 147
           + Q A  K +    N +A KY
Sbjct: 126 EVQAAFQKLVTGVANALAHKY 146


Go to top
>prf|1204171B|hemoglobin beta
          Length = 146

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSDGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LSDGEKNAISTAWGKVNA--ADIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N +A KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALAHKY 145


Go to top
>sp|P08853|HBB_MARMA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSDGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LSDGEKNAISTAWGKVNA--ADIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N +A KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALAHKY 145


Go to top
>sp|P02067|HBB_PIG Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 147

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E + VL +WGKV  D  G   E L  L   +P T   F+ F +L + + +  +  +
Sbjct: 4   LSAEEKEAVLGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +    +  VI+ VL +R   
Sbjct: 62  KAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGH 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  + Q A  K +    N +A KY
Sbjct: 122 DFNPNVQAAFQKVVAGVANALAHKY 146


Go to top
>tr|A4ZQU6|A4ZQU6_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSYCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>sp|Q28496|HBE_MICMU Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +L++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ILSLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q 
Sbjct: 70  TSFGEAVKNLDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>prf|0503179A|hemoglobin gamma
          Length = 146

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL  R+  +F  + Q 
Sbjct: 69  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIRFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVAGVASALSSRY 145


Go to top
>sp|P02097|HBG_MACNE Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 146

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL  R+  +F  + Q 
Sbjct: 69  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIRFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVAGVASALSSRY 145


Go to top
>prf|0605229A|hemoglobin
          Length = 141

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 6/146 (4%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   VL+I GK+    +  G E L  LF + P+T   F  F      +    S DL
Sbjct: 2   LSASEKAAVLSIVGKIGSQGSALGSEALTRLFLSFPQTKTYFPHF------DLTPGSADL 55

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
             HG  ++ AL          A  +  L+  HA   ++       ++ +I  VL   + G
Sbjct: 56  NTHGGKIINALAGAANHLDDLAGNLSSLSDLHAYNLRVDPGNFPLLAHIIQVVLATHFPG 115

Query: 123 DFGADAQGAMSKALELFRNDIAAKYK 148
           DF A+ Q A  K L L    + +KY+
Sbjct: 116 DFTAEVQAAWDKFLALVSAVLTSKYR 141


Go to top
>sp|P02011|HBA3_RANCA Hemoglobin subunit alpha-3 (Hemoglobin alpha-3
           chain) (Alpha-3-globin) (Hemoglobin alpha-III chain,
           larval).
          Length = 141

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 6/146 (4%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   VL+I GK+    +  G E L  LF + P+T   F  F      +    S DL
Sbjct: 2   LSASEKAAVLSIVGKIGSQGSALGSEALTRLFLSFPQTKTYFPHF------DLTPGSADL 55

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
             HG  ++ AL          A  +  L+  HA   ++       ++ +I  VL   + G
Sbjct: 56  NTHGGKIINALAGAANHLDDLAGNLSSLSDLHAYNLRVDPGNFPLLAHIIQVVLATHFPG 115

Query: 123 DFGADAQGAMSKALELFRNDIAAKYK 148
           DF A+ Q A  K L L    + +KY+
Sbjct: 116 DFTAEVQAAWDKFLALVSAVLTSKYR 141


Go to top
>prf|0709223A|hemoglobin
          Length = 141

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 8/148 (5%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
            L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S  
Sbjct: 1   SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSAQ 54

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKRY 120
           L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R+
Sbjct: 55  LRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAARF 113

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A+A  A  K L +  + +  KY+
Sbjct: 114 PADFTAEAHAAWDKFLSVVSSVLTEKYR 141


Go to top
>pdb|1JEB_C|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA
           CHAIN; CHAIN: A, C
          Length = 141

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 8/148 (5%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
            L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S  
Sbjct: 1   SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSAQ 54

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKRY 120
           L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R+
Sbjct: 55  LRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAARF 113

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A+A  A  K L +  + +  KY+
Sbjct: 114 PADFTAEAHAAWDKFLSVVSSVLTEKYR 141


Go to top
>pdb|1JEB_A|2.10| 4| 141|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN ZETA
           CHAIN; CHAIN: A, C
          Length = 141

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 8/148 (5%)

Query: 2   GLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSED 61
            L+  E  +++++W K+       G E L  LF +HP+T   F  F      +    S  
Sbjct: 1   SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSAQ 54

Query: 62  LKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKRY 120
           L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R+
Sbjct: 55  LRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAARF 113

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A+A  A  K L +  + +  KY+
Sbjct: 114 PADFTAEAHAAWDKFLSVVSSVLTEKYR 141


Go to top
>sp|Q95238|HBE_PROVE Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +L++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ILSVWGKVNVEEAG--GEALGRLLVVYPWTQRFFDNFGNLSSPSAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +  + +   ++ +L   +  +F  D Q 
Sbjct: 70  TSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNAMVIILATHFGKEFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>tr|Q38IW4|Q38IW4_XENTR Alpha globin larval-2 (Putative
           uncharacterized protein).
          Length = 142

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M LS+ E   +L++W K  G++   G E L  +F  +P+T+  F    +L S      S 
Sbjct: 1   MILSEAEKAAILSLWAKASGNVNALGAEALERMFLTYPQTMTYFSHL-DLSS-----GSH 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           DL+ HG  VL A+G   K        +  L+  HA   ++       +S  I   L   +
Sbjct: 55  DLQVHGGKVLGAIGEATKHLDNLHEALSALSALHAYNLRVDPGNFRLLSHAIEVTLAVHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             DF A AQ A  K L      + ++Y+
Sbjct: 115 PDDFDATAQAAWDKFLAAISTALTSQYR 142


Go to top
>tr|A4ZQT3|A4ZQT3_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILNEKYR 142


Go to top
>prf|1008177B|hemoglobin beta
          Length = 146

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + E +  + 
Sbjct: 1   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTAEAVLHNA 58

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 59  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 118

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 119 GKEFTPDVQAAYEKVVAGVANALAHKY 145


Go to top
>sp|P02085|HBB_LOXAF Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + E +  + 
Sbjct: 1   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTAEAVLHNA 58

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 59  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 118

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 119 GKEFTPDVQAAYEKVVAGVANALAHKY 145


Go to top
>prf|0910241A|globin epsilonI,beta
          Length = 147

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 59/137 (43%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +  +WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITGLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  VI+ +L   +  +F  D Q 
Sbjct: 70  TSFGEAIKNLDNLKGAFAKLSELHCDKLHVDPENFRLLGNVIVIILATHFGREFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>sp|P02102|HBE1_CAPHI Hemoglobin subunit epsilon-1 (Hemoglobin
           epsilon-1 chain) (Epsilon-1- globin) (Hemoglobin
           epsilon-I chain).
          Length = 147

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 59/137 (43%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +  +WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITGLWGKVNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  VI+ +L   +  +F  D Q 
Sbjct: 70  TSFGEAIKNLDNLKGAFAKLSELHCDKLHVDPENFRLLGNVIVIILATHFGREFTPDVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>sp|Q45XJ0|HBD_LOXAF Hemoglobin subunit delta (Hemoglobin delta
           chain) (Delta-globin).
          Length = 147

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + E +  + 
Sbjct: 2   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTAEAVLHNA 59

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 60  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 119

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 120 GKEFTPDVQAAYEKVVAGVANALAHKY 146


Go to top
>tr|Q1W6G9|Q1W6G9_HUMAN Hemoglobin zeta subunit.
          Length = 142

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E  +++++W K+       G E L   F +HP+T   F  F      +    S 
Sbjct: 1   MSLTKTERTIIVSMWAKISTQADTIGTETLERPFLSHPQTKTYFPHF------DLHPGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  V+ A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+A  A  K L +  + +  KY+
Sbjct: 114 FPADFTAEAHAAWDKFLSVVSSVLTEKYR 142


Go to top
>prf|0707234A|globin beta-like rho
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 63/139 (45%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ ++W KV  ++   G E L  L   +P T   FD F NL S   +  +  ++ HG  
Sbjct: 9   QLITSVWSKV--NVEECGAEALARLLIVYPWTQRFFDNFGNLSSPTAIIGNPKVRAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VL++ G  +K           L++ H  K  +  +    +  ++I VL   ++ DF  + 
Sbjct: 67  VLSSFGEAVKNLDNIKNTYAKLSELHCEKLHVDPENFRLLGNILIIVLAAHFTKDFTPEC 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +    +A KY
Sbjct: 127 QAAWQKLVSVVAKALARKY 145


Go to top
>prf|0309296B|hemoglobin beta
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   V  +WGKV  DL   G + L SL   +P T   FD F +L S   + S+  +
Sbjct: 3   LSGEEKAAVTGLWGKV--DLEKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+    L            L++ H  K  +  +    +  V+++VL   +  
Sbjct: 61  KAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGP 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F    Q A  K +    N +A KY
Sbjct: 121 EFTPQVQAAFQKVVAGVANALAHKY 145


Go to top
>sp|P02052|HBB_TUPGL Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 63/145 (43%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E   V  +WGKV  DL   G + L SL   +P T   FD F +L S   + S+  +
Sbjct: 3   LSGEEKAAVTGLWGKV--DLEKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VLT+    L            L++ H  K  +  +    +  V+++VL   +  
Sbjct: 61  KAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGP 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F    Q A  K +    N +A KY
Sbjct: 121 EFTPQVQAAFQKVVAGVANALAHKY 145


Go to top
>prf|711676A|globin beta
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E  ++ ++WGK+  D+   G E L  L   +P T   FD F +L S + +  +  +
Sbjct: 3   LSSEEKGLITSLWGKI--DIEQTGGEALGRLLIVYPWTSRFFDHFGDLSSAKAVLGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
             HG  VL + G  +K           L++ H  K  +  +  + +  V++  L + +  
Sbjct: 61  LAHGAKVLVSFGDAIKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVICLAEHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  DAQ A  K +    N +A KY
Sbjct: 121 DFTIDAQVAWQKLVAGVANALAHKY 145


Go to top
>sp|P02108|HBB_POTTR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 66/145 (45%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LS  E  ++ ++WGK+  D+   G E L  L   +P T   FD F +L S + +  +  +
Sbjct: 3   LSSEEKGLITSLWGKI--DIEQTGGEALGRLLIVYPWTSRFFDHFGDLSSAKAVLGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
             HG  VL + G  +K           L++ H  K  +  +  + +  V++  L + +  
Sbjct: 61  LAHGAKVLVSFGDAIKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVICLAEHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  DAQ A  K +    N +A KY
Sbjct: 121 DFTIDAQVAWQKLVAGVANALAHKY 145


Go to top
>sp|P18435|HBE_TARSY Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           V ++WGK+  D AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  VTSLWGKMNVDEAG--GEALGRLLVVYPWTQRFFDNFGNLSSSSAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  V++ +L   +  DF  + Q 
Sbjct: 70  TSFGDAIKNMDNLKGAFAKLSELHCDKLHVDPENFRLLGNVLVIILVTHFGKDFTPEVQV 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      +A KY
Sbjct: 130 AWQKLVSGVATALAHKY 146


Go to top
>prf|1212251B|hemoglobin betaII
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSDGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LSDGEKNAISTAWGKVHA--AEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N +A KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALAHKY 145


Go to top
>sp|P09421|HBB_SPECI Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           LSDGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LSDGEKNAISTAWGKVHA--AEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N +A KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALAHKY 145


Go to top
>tr|A4ZQT9|A4ZQT9_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     ++ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLSSALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|A4ZQV8|A4ZQV8_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHYGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     ++ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLSSALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>prf|1503170A|hemoglobin beta
          Length = 146

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  +V  +WGKV  D    G E L  L    P T   F+ F +L S   + ++  +
Sbjct: 3   LTDAEKNLVSGLWGKVNADAV--GAEALGRLLVVTPWTQRFFEHFGDLSSASAVMNNPQV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +II VL      
Sbjct: 61  KAHGKKVIHSFADGLKHLDNLKGAFSSLSELHCDKLHVDPENFKLLGNMIIIVLSHDLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +A KY
Sbjct: 121 DFTPSAQSAFHKVVAGVANALAHKY 145


Go to top
>sp|Q28931|HBE_SMICR Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon-globin) (Hemoglobin embryonic beta
           chain).
          Length = 147

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 62/141 (43%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E   +  IWGKV  ++   G E L  L   +P T   FD F NL S   +  +  +K HG
Sbjct: 8   EKNAITTIWGKV--NVEETGGEALGRLLVVYPWTQRFFDSFGNLSSASAILGNPKVKAHG 65

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VLT+ G  +K           L++ H  K  +  +    +  V++ V+   ++ +F  
Sbjct: 66  KKVLTSFGDAVKNLDNLKGTFSKLSELHCDKLHVDPENFRLLGNVLVIVMAAHFNKEFTP 125

Query: 127 DAQGAMSKALELFRNDIAAKY 147
           + Q A  K +    N +A KY
Sbjct: 126 EVQAAFQKLVTGVANALAHKY 146


Go to top
>sp|P18707|HBB_MESBR Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  +V  +WGKV  D    G E L  L    P T   F+ F +L S   + ++  +
Sbjct: 3   LTDAEKNLVSGLWGKVNADAV--GAEALGRLLVVTPWTQRFFEHFGDLSSASAVMNNPQV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +II VL      
Sbjct: 61  KAHGKKVIHSFADGLKHLDNLKGAFSSLSELHCDKLHVDPENFKLLGNMIIIVLSHDLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +A KY
Sbjct: 121 DFTPSAQSAFHKVVAGVANALAHKY 145


Go to top
>tr|Q28460|Q28460_MIRAN MRNA, . (Fragment).
          Length = 146

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 65/145 (44%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E   V ++WGKV+ D  G   E L  L   +P T   FD F +L S   + S+  +
Sbjct: 3   LTAEEKSAVTSLWGKVKVDEVG--GEALGRLLVVYPWTQRFFDSFGDLSSPNAIMSNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  VL +    LK           L++ H  +  +  +  + +  V++ VL + +  
Sbjct: 61  KAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDQLHVDPENFKLLGNVLVCVLARHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F    QGA  K +    N +A KY
Sbjct: 121 EFTPQMQGAFQKVVAGVANALAHKY 145


Go to top
>prf|1814374A|beta globin
          Length = 147

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +++++WGKV  + AG   E L  L   +P T   F+ F NL S   +  +  +K HG  V
Sbjct: 11  IIMSLWGKVNIEEAG--GEALARLLVVYPWTQRFFETFGNLSSASAIMGNPKVKAHGKKV 68

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           LT+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q
Sbjct: 69  LTSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQ 128

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +      +A KY
Sbjct: 129 AAWQKLVSGVATALAHKY 146


Go to top
>tr|A4ZQV0|A4ZQV0_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KPLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|Q61600|Q61600_MOUSE Beta-H1-globin (Fragment).
          Length = 140

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + +IW KV  DL   G E L  L   +P T   FDKF NL S   +  +  ++ HG  VL
Sbjct: 5   ITSIWDKV--DLEKVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRAHGKKVL 62

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K        I  L++ H  K  +  +  + +  +++ VL   ++ +F  + Q 
Sbjct: 63  TSLGLGVKNMDNLKETIAHLSELHCDKLHVDPENFKLLGNMLVIVLSTHFAKEFTPEVQA 122

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +    N ++ KY
Sbjct: 123 AWQKLVIGVANALSHKY 139


Go to top
>sp|P04443|HBB0_MOUSE Hemoglobin subunit beta-H0 (Hemoglobin beta-H0
           chain) (Beta-H0- globin).
          Length = 147

 Score = 59.3 bits (142), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + +IW KV  DL   G E L  L   +P T   FDKF NL S + +  +  +K HG  VL
Sbjct: 12  ITSIWDKV--DLEKVGGETLGRLLIVYPWTQRFFDKFGNLSSAQAIMGNPRIKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K     +  + +  +++ VL   +  +F A+AQ 
Sbjct: 70  TSLGLAVKNMDNLKETFAHLSELHCDKLHADPENFKLLGNMLVIVLSSYFGKEFTAEAQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      ++ KY
Sbjct: 130 AWQKLVVGVATALSHKY 146


Go to top
>tr|O88754|O88754_RAT Epsilon 3 globin (Hemoglobin, gamma A).
          Length = 147

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +++IW KV  DL   G E L  L   +P T   FDKF NL S   +  +  ++ HG  VL
Sbjct: 12  IISIWEKV--DLEKIGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG+ ++           L++ H  K  +  +  + +  +++ VL   ++ +F  + Q 
Sbjct: 70  TSLGSAVENMDNLKETFAHLSELHCDKLHVDPQNFKLLGNMLVIVLSTHFAKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +    N ++ KY
Sbjct: 130 AWQKLVMGVANALSHKY 146


Go to top
>sp|Q45XI9|HBD_ELEMA Hemoglobin subunit delta (Hemoglobin delta
           chain) (Delta-globin).
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + + +  + 
Sbjct: 2   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTADAVLHNA 59

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 60  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 119

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 120 GKEFTPDVQAAYEKVVAGVANALAHKY 146


Go to top
>sp|P02007|HBPI_CHICK Hemoglobin subunit pi (Hemoglobin pi chain)
           (Pi-globin) (Hemoglobin pi' chain).
          Length = 142

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  E   V  IW KV   +   G E L  LF ++P+T   F  F      +  + S 
Sbjct: 1   MALTQAEKAAVTTIWAKVATQIESIGLESLERLFASYPQTKTYFPHF------DVSQGSV 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  VL A+G  +K        +  L++ HA   ++ PV + + +S  I+  +  R
Sbjct: 55  QLRGHGSKVLNAIGEAVKNIDDIRGALAKLSELHAYILRVDPVNF-KLLSHCILCSVAAR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           Y  DF  +   A  K L    + +  KY+
Sbjct: 114 YPSDFTPEVHAAWDKFLSSISSVLTEKYR 142


Go to top
>prf|2206405C|hemoglobin
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           +++IW KV  DL   G E L  L   +P T   FDKF NL S   +  +  ++ HG  VL
Sbjct: 11  IISIWEKV--DLEKIGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG+ ++           L++ H  K  +  +  + +  +++ VL   ++ +F  + Q 
Sbjct: 69  TSLGSAVENMDNLKETFAHLSELHCDKLHVDPQNFKLLGNMLVIVLSTHFAKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +    N ++ KY
Sbjct: 129 AWQKLVMGVANALSHKY 145


Go to top
>tr|A4ZQT1|A4ZQT1_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     ++ +  L + HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLSSALTKLGELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>prf|0808262B|hemoglobin beta
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + + +  + 
Sbjct: 1   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTADAVLHNA 58

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 59  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 118

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 119 GKEFTPDVQAAYEKVVAGVANALAHKY 145


Go to top
>sp|P02084|HBB_ELEMA Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           + L+  E   V N+WGKV  ++   G E L  L   +P T   F+ F +L + + +  + 
Sbjct: 1   VNLTAAEKTQVTNLWGKV--NVKELGGEALSRLLVVYPWTRRFFEHFGDLSTADAVLHNA 58

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
            +  HG  VLT+ G  LK           L++ H  K  +  +    +  V++ VL + +
Sbjct: 59  KVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVIVLARHF 118

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKY 147
             +F  D Q A  K +    N +A KY
Sbjct: 119 GKEFTPDVQAAYEKVVAGVANALAHKY 145


Go to top
>sp|P02105|HBE2_CAPHI Hemoglobin subunit epsilon-2 (Hemoglobin
           epsilon-2 chain) (Epsilon-2- globin) (Hemoglobin
           epsilon-II chain).
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           V ++W KV  ++ G   E L  L   +P T   FD F NL SE  +  +  +K HG  VL
Sbjct: 12  VASLWAKVNVEVVG--GESLARLLIVYPWTQRFFDSFGNLCSESAIMGNPKVKAHGRKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
            + G  +K           L++ H  K  +       +  +I+ VL   +S +F    Q 
Sbjct: 70  NSFGNAIKHMDDLKGTFADLSELHCDKLHVDPPNFRLLGNMILIVLATHFSKEFTPQMQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K      N +A KY
Sbjct: 130 AWQKLTNAVANALAHKY 146


Go to top
>prf|2618363A|globin
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +WGKV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LTDAEKAAVSGLWGKVNSDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    L            L++ H  K  +  +    +  +I+ VL      
Sbjct: 61  KAHGKKVITAFNEGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 121 DFTPAAQAAFQKVMAGVATALAHKY 145


Go to top
>prf|1409215B|hemoglobin beta
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E  +V+ +W KV  ++  +G E L  L   +P T   F+ F +L S   + ++  +
Sbjct: 3   LTPEEKALVIGLWAKV--NVKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V T+ G  LK           L++ H  K  +  +    +  V++ VL + +  
Sbjct: 61  KAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F  +AQ A  K +    N +A KY
Sbjct: 121 EFSPEAQAAYQKVVAGVANALAHKY 145


Go to top
>tr|A6NC93|A6NC93_HUMAN Uncharacterized protein ENSP00000346992
           (Fragment).
          Length = 134

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 67/140 (47%), Gaps = 8/140 (5%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +++++W K+       G E L  LF +HP+T   F  F      +    S  L+ HG  V
Sbjct: 2   IIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF------DLHPGSAQLRAHGSKV 55

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKRYSGDFGADA 128
           + A+G  +K        +  L++ HA   ++ PV + + +S  ++  L  R+  DF A+A
Sbjct: 56  VAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNF-KLLSHCLLVTLAARFPADFTAEA 114

Query: 129 QGAMSKALELFRNDIAAKYK 148
             A +K L +  + +  KY+
Sbjct: 115 HAAWAKFLSVVSSVLTEKYR 134


Go to top
>sp|P07415|HBB_TRIIN Hemoglobin subunit beta (Hemoglobin beta chain)
           (Beta-globin).
          Length = 146

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E  +V+ +W KV  ++  +G E L  L   +P T   F+ F +L S   + ++  +
Sbjct: 3   LTPEEKALVIGLWAKV--NVKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V T+ G  LK           L++ H  K  +  +    +  V++ VL + +  
Sbjct: 61  KAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F  +AQ A  K +    N +A KY
Sbjct: 121 EFSPEAQAAYQKVVAGVANALAHKY 145


Go to top
>prf|2706400B|globin
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q +  IW K++ +  G G   L  L   +P T   F  F NL S + ++ +  ++ HG  
Sbjct: 10  QAISTIWAKIDIEEVGAG--ALSRLLVVYPWTQRYFSNFGNLSSPQAIEGNPRVRNHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      A    L++ H+ K  +  +    + + +I VL      DF  +A
Sbjct: 68  VLTSFGEAVKNLDNVKATFDKLSELHSDKLHVDPQNFRLLGDNLIIVLAATMGKDFTPEA 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + ++ KY
Sbjct: 128 QAAWQKLVGVVASALSRKY 146


Go to top
>tr|Q9BEI1|Q9BEI1_SMICR Omega globin.
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q +  IW K++ +  G G   L  L   +P T   F  F NL S + ++ +  ++ HG  
Sbjct: 10  QAISTIWAKIDIEEVGAG--ALSRLLVVYPWTQRYFSNFGNLSSPQAIEGNPRVRNHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K      A    L++ H+ K  +  +    + + +I VL      DF  +A
Sbjct: 68  VLTSFGEAVKNLDNVKATFDKLSELHSDKLHVDPQNFRLLGDNLIIVLAATMGKDFTPEA 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K + +  + ++ KY
Sbjct: 128 QAAWQKLVGVVASALSRKY 146


Go to top
>tr|B1Q450|B1Q450_MOUSE Hemoglobin beta chain subunit.
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +WGKV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 4   LTDAEKAAVSGLWGKVNSDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    L            L++ H  K  +  +    +  +I+ VL      
Sbjct: 62  KAHGKKVITAFNEGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 122 DFTPAAQAAFQKVMAGVATALAHKY 146


Go to top
>sp|Q45XI8|HBD_TRIMA Hemoglobin subunit delta (Hemoglobin delta
           chain) (Delta-globin).
          Length = 147

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+  E  +V+ +W KV  ++  +G E L  L   +P T   F+ F +L S   + ++  +
Sbjct: 4   LTPEEKALVIGLWAKV--NVKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V T+ G  LK           L++ H  K  +  +    +  V++ VL + +  
Sbjct: 62  KAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F  +AQ A  K +    N +A KY
Sbjct: 122 EFSPEAQAAYQKVVAGVANALAHKY 146


Go to top
>prf|2305272A|globin
          Length = 147

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +++++WGKV  + AG   E L  L   +P T   F+ F NL S   +  +  +K HG  V
Sbjct: 11  IIMSLWGKVNIEEAG--GEALGRLLVVYPWTQRFFETFGNLSSASAIMGNPKVKAHGKKV 68

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           LT+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q
Sbjct: 69  LTSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQ 128

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +      +A KY
Sbjct: 129 AAWQKLVSGVATALAHKY 146


Go to top
>sp|P19759|HBE_GALCR Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +++++WGKV  + AG   E L  L   +P T   F+ F NL S   +  +  +K HG  V
Sbjct: 11  IIMSLWGKVNIEEAG--GEALGRLLVVYPWTQRFFETFGNLSSASAIMGNPKVKAHGKKV 68

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           LT+ G  +K           L++ H  K  +  +  + +  V++ +L   +  +F  D Q
Sbjct: 69  LTSFGEAVKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPDVQ 128

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +      +A KY
Sbjct: 129 AAWQKLVSGVATALAHKY 146


Go to top
>prf|1408288A|hemoglobin betaM
          Length = 147

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++W KV  D+   G E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSVWTKV--DVEDVGGESLARLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  V+I VL  R+  +F  + Q 
Sbjct: 70  TSFGEGVKNMDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLIIVLASRFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +  + + +  KY
Sbjct: 130 SWQKLVSGYSSALGHKY 146


Go to top
>sp|P02101|HBE_PIG Hemoglobin subunit epsilon (Hemoglobin epsilon
           chain) (Epsilon- globin).
          Length = 147

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
            ++  +WGKV  +  G GQ V   L   +P T   FD F N+ S   +  +  +K HG  
Sbjct: 10  SVITGLWGKVNVEETG-GQAVG-RLLVVYPWTQRFFDSFGNMSSPSAIMGNPKVKAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLTA G  +K           L++ H  K  +  +    +  +I+ +L   + G+F  + 
Sbjct: 68  VLTAFGDAVKNMDNLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIILASHFGGEFTPEV 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +      +A KY
Sbjct: 128 QAAWQKLVAGVATALAHKY 146


Go to top
>tr|A4ZQT6|A4ZQT6_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  D  A+   A  K + +  + +  KY+
Sbjct: 114 FPADLTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>prf|1716215B|hemoglobin III beta
          Length = 146

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E Q++ ++WGK++  L G   E L  L   +P T  +F  F NL S   +  +  +K HG
Sbjct: 7   EKQLICSLWGKIDVGLIG--GETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHG 64

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VLT+ G  +K           L++ H  K  +     + +  V++ VL   +  +F  
Sbjct: 65  KKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTP 124

Query: 127 DAQGAMSKALELFRNDIAAKY 147
               A  K + +  + +A +Y
Sbjct: 125 AHHAAYQKLVNVVSHSLARRY 145


Go to top
>sp|P18993|HBB1_VAREX Hemoglobin subunit beta-1 (Hemoglobin beta-1
           chain) (Beta-1-globin) (Hemoglobin beta-I chain).
          Length = 146

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E Q++ ++WGK++  L G   E L  L   +P T  +F  F NL S   +  +  +K HG
Sbjct: 7   EKQLICSLWGKIDVGLIG--GETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHG 64

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VLT+ G  +K           L++ H  K  +     + +  V++ VL   +  +F  
Sbjct: 65  KKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTP 124

Query: 127 DAQGAMSKALELFRNDIAAKY 147
               A  K + +  + +A +Y
Sbjct: 125 AHHAAYQKLVNVVSHSLARRY 145


Go to top
>tr|A4ZQW6|A4ZQW6_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     A+ +  L++ HA   ++ PV + + +S  ++  L   
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLASALTKLSELHAYILRVDPVNF-KLLSHCLLVTLASH 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>tr|Q549G1|Q549G1_HUMAN PRO2979 (Hemoglobin, gamma A).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTAVASALSSRY 146


Go to top
>sp|P61920|HBG1_PANTR Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1-globin) (Hemoglobin gamma-A chain).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTAVASALSSRY 146


Go to top
>sp|Q28779|HBG1_PANPA Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1-globin) (Hemoglobin gamma-A chain).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTAVASALSSRY 146


Go to top
>sp|P69891|HBG1_HUMAN Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1-globin) (Hemoglobin gamma-A chain) (Hb F
           Agamma).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTAVASALSSRY 146


Go to top
>sp|P62741|HBG1_GORGO Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1-globin) (Hemoglobin gamma-A chain).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGGAIKHLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTAVASALSSRY 146


Go to top
>prf|2618363C|globin
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +WGKV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LTDAEKAAVSCLWGKVNSDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    L            L++ H  K  +  +    +  +I+ VL      
Sbjct: 61  KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 121 DFTPAAQAAFQKVVAGVATALAHKY 145


Go to top
>prf|711677A|hemoglobin gamma
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVTAVASALSSRY 145


Go to top
>pdb|1I3E_B|1.86| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA
           CHAINS; CHAIN: A,
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVTAVASALSSRY 145


Go to top
>pdb|1I3E_A|1.86| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA
           CHAINS; CHAIN: A,
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVTAVASALSSRY 145


Go to top
>pdb|1I3D_B|1.70| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA
           CHAINS; CHAIN: A,
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVTAVASALSSRY 145


Go to top
>pdb|1I3D_A|1.70| 2| 146|N|MOL_ID: 1; MOLECULE: HEMOGLOBIN GAMMA
           CHAINS; CHAIN: A,
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVTAVASALSSRY 145


Go to top
>tr|A8DUK0|A8DUK0_MOUSE Beta-globin.
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +WGKV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 4   LTDAEKAAVSCLWGKVNSDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    L            L++ H  K  +  +    +  +I+ VL      
Sbjct: 62  KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 122 DFTPAAQAAFQKVVAGVATALAHKY 146


Go to top
>sp|P02088|HBB1_MOUSE Hemoglobin subunit beta-1 (Hemoglobin beta-1
           chain) (Beta-1-globin) (Hemoglobin beta-major chain).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 59/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +WGKV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 4   LTDAEKAAVSCLWGKVNSDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    L            L++ H  K  +  +    +  +I+ VL      
Sbjct: 62  KAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 122 DFTPAAQAAFQKVVAGVATALAHKY 146


Go to top
>sp|P04246|HBT_PIG Hemoglobin subunit theta (Hemoglobin theta chain)
           (Theta-globin).
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
            ++  +WGKV  ++   G E +  L   +P T   FD F N+ S   +  +  +K HG  
Sbjct: 9   SVITGLWGKV--NVEETGGEAVGRLLVVYPWTQRFFDSFGNMSSPSAIMGNPKVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    +  +I+ +L   + G+F  + 
Sbjct: 67  VLTSFGDAVKNMDNLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIILASHFGGEFTPEV 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +      +A KY
Sbjct: 127 QAAWQKLVAGVATALAHKY 145


Go to top
>tr|A8DV41|A8DV41_MOUSE Beta-globin.
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 58/145 (40%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +W KV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 4   LTDAEKSAVSCLWAKVNPDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    LK           L++ H  K  +  +    +   I+ VL      
Sbjct: 62  KAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVTVLGHHLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +      +A KY
Sbjct: 122 DFTPAAQAAFQKVVAGVATALAHKY 146


Go to top
>sp|P18995|HBG1_PONPY Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1- globin).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTGVASALSSRY 146


Go to top
>tr|A9L8Y0|A9L8Y0_PAPAN Hemoglobin subunit gamma (Predicted).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>sp|P68079|HBG_PAPCY Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>sp|P68077|HBG_MACMU Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>sp|P68078|HBG_MACFU Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>tr|A4ZQV9|A4ZQV9_PERMA Hemoglobin subunit zeta.
          Length = 142

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 70/149 (46%), Gaps = 8/149 (5%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L   E  +++++W K+       G E L  LF ++P+T   F  F      +    S+
Sbjct: 1   MSLMKNERAIIMSMWDKMASQAEAIGTETLERLFCSYPQTKTYFPHF------DLHHGSQ 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI-PVKYLEFISEVIIQVLKKR 119
            L+ HG  +L A+G  +K     ++ +  L++ HA   ++ PV + +  S  ++  L  R
Sbjct: 55  QLRVHGSKILAAVGDAVKNIDNLSSALTKLSELHAYILRVDPVNF-KLPSHCLLVTLASR 113

Query: 120 YSGDFGADAQGAMSKALELFRNDIAAKYK 148
           +  DF A+   A  K + +  + +  KY+
Sbjct: 114 FPADFTAEVHEAWDKFMSILSSILTEKYR 142


Go to top
>prf|0910241B|globin epsilonII,beta
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           V ++W KV  ++ G   E L  L   +P T   FD F NL SE  +  +  +K HG  VL
Sbjct: 12  VASLWAKVNVEVVG--GESLGRLLIVYPWTQRFFDSFGNLCSESAIMGNPKVKAHGRKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
            + G  +K           L++ H  K  +       +  +I+ VL   +S +F    Q 
Sbjct: 70  NSFGNAIKHMDDLKGTFADLSELHCDKLHVDPPNFRLLGNMILIVLATHFSKEFTPQMQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K      N +A KY
Sbjct: 130 AWQKLTNAVANALAHKY 146


Go to top
>prf|1109157B|hemoglobin beta
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +V  +WGKV  D  G   E L  L   +P T   F+ F +L S + + S+  +K HG  V
Sbjct: 10  LVNGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSSADAIMSNAKVKAHGKKV 67

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           L +    LK           L++ H  K  +  +    +  V++ VL   +  DF    Q
Sbjct: 68  LNSFSDGLKNIDDLKGAFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGHDFNPQVQ 127

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +    N +A KY
Sbjct: 128 AAFQKVVAGVANALAHKY 145


Go to top
>prf|0709277A|globin rho'
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ ++W KV  ++   G E L  L   +P T   FD F NL S   +  +  ++ HG  
Sbjct: 10  QLITSVWSKV--NVEECGAEALARLLIVYPWTQRFFDNFGNLSSPTAIIGNPKVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VL++ G  +K           L++ H  K  +  +    +  ++I VL   ++ DF    
Sbjct: 68  VLSSFGEAVKNLDNIKNTYAKLSELHCEKLHVDPENFRLLGNILIIVLAAHFTKDFTPTC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q    K + +  + +A KY
Sbjct: 128 QAVWQKLVSVVAHALAYKY 146


Go to top
>sp|P02127|HBRH_CHICK Hemoglobin subunit rho (Hemoglobin rho chain)
           (Rho-globin).
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
           Q++ ++W KV  ++   G E L  L   +P T   FD F NL S   +  +  ++ HG  
Sbjct: 10  QLITSVWSKV--NVEECGAEALARLLIVYPWTQRFFDNFGNLSSPTAIIGNPKVRAHGKK 67

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VL++ G  +K           L++ H  K  +  +    +  ++I VL   ++ DF    
Sbjct: 68  VLSSFGEAVKNLDNIKNTYAKLSELHCEKLHVDPENFRLLGNILIIVLAAHFTKDFTPTC 127

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q    K + +  + +A KY
Sbjct: 128 QAVWQKLVSVVAHALAYKY 146


Go to top
>sp|P07412|HBB_FELCA Hemoglobin subunit beta-A/B (Hemoglobin
           beta-A/B chain) (Beta-A/B- globin).
          Length = 146

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 2/138 (1%)

Query: 10  MVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTV 69
           +V  +WGKV  D  G   E L  L   +P T   F+ F +L S + + S+  +K HG  V
Sbjct: 10  LVNGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSSADAIMSNAKVKAHGKKV 67

Query: 70  LTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQ 129
           L +    LK           L++ H  K  +  +    +  V++ VL   +  DF    Q
Sbjct: 68  LNSFSDGLKNIDDLKGAFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGHDFNPQVQ 127

Query: 130 GAMSKALELFRNDIAAKY 147
            A  K +    N +A KY
Sbjct: 128 AAFQKVVAGVANALAHKY 145


Go to top
>prf|1603302A|gamma globin
          Length = 147

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGGAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVTGVASALSSRY 146


Go to top
>prf|1111202B|hemoglobin beta
          Length = 146

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+DGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LTDGEKNAISTAWGKVNA--AEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N ++ KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALSHKY 145


Go to top
>sp|P07410|HBB_SPETO Hemoglobin subunit beta-S/F (Hemoglobin
           beta-S/F chain) (Beta-S/F- globin).
          Length = 146

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+DGE   +   WGKV    A  G E L  L   +P T   FD F +L S   +  +  +
Sbjct: 3   LTDGEKNAISTAWGKVNA--AEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKV 60

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +I+ V+      
Sbjct: 61  KAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGK 120

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF  +AQ A  K +    N ++ KY
Sbjct: 121 DFTPEAQAAFQKVVAGVANALSHKY 145


Go to top
>prf|1111329A|globin gamma
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  D+   G E L  L   +P T   FD F +L S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKV--DVEDAGGETLGRLLVVYPWTQRFFDSFGSLSSPSAIMGNPKVKAHGVKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGEAIKNLDDLKGTFGQLSELHCDKLHVDPENFRLLGNVLVTVLAILHGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + +A++Y
Sbjct: 130 SWQKMVAGVASALASRY 146


Go to top
>prf|1813173B|globin
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E  +V  +WGKV  D    G E L  L   +P T   F+ F +L     + ++  +
Sbjct: 4   LTDAEKALVTGLWGKVNADAV--GAEALGRLLVVYPWTQRFFEHFGDLSLPVAVMNNPQV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+ +    LK           L++ H  K  +  +  + +  +II VL      
Sbjct: 62  KAHGKKVIHSFADGLKHLDNLKGAFSSLSELHCDKLHVDPENFKLLGNMIIIVLSHDLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           DF   AQ A  K +    N +A KY
Sbjct: 122 DFTPSAQSAFHKVVAGVANALAHKY 146


Go to top
>tr|B2DBE5|B2DBE5_MUSCR Hemoglobin beta 2.
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 61/145 (42%), Gaps = 2/145 (1%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E   V  +W KV  D  G   E L  L   +P T   FD F +L S   +  +  +
Sbjct: 4   LTDAEKAAVSCMWAKVNPDEVG--GEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKV 61

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V+TA    LK           L++ H  K  +  +  + +   I+ VL      
Sbjct: 62  KAHGKKVITAFNDGLKNLDNLKGTFASLSELHCDKLHVDPENFKLLGNSIVIVLGHHLGK 121

Query: 123 DFGADAQGAMSKALELFRNDIAAKY 147
           +F +DAQ A  K +      +A KY
Sbjct: 122 EFTSDAQAAFQKVVAGVATALAHKY 146


Go to top
>prf|1208300A|hemoglobin gamma
          Length = 146

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVAGVASALSSRY 145


Go to top
>prf|0611197A|hemoglobin gamma
          Length = 146

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 11  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 68

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 69  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 128

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 129 SWQKMVAGVASALSSRY 145


Go to top
>sp|Q45XH7|HBG_ELEMA Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WG+V  ++   G E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGQV--NVEETGGEALGRLLVVYPWTQRFFDTFGNLSSASAIMGNPRVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+ G  +K           L++ H  K  +  +    +  V++ VL   +  +F    Q 
Sbjct: 70  TSFGDAVKNLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLANHFGKEFTPQVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +    N +A KY
Sbjct: 130 AWQKMVTGVANALAYKY 146


Go to top
>sp|P61947|HBG1_HYLLA Hemoglobin subunit gamma-1 (Hemoglobin gamma-1
           chain) (Gamma-1-globin) (Hemoglobin gamma-A chain).
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGGAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>tr|A9L8X9|A9L8X9_PAPAN Hemoglobin subunit gamma-1 (Predicted).
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAVKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>prf|1004285A|globin betah0
          Length = 147

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + +IW KV  DL   G E L  L   +P T   FDKF NL S   +  +  ++ HG  VL
Sbjct: 12  ITSIWDKV--DLEKVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +  + +  +++ VL   +  +F A+AQ 
Sbjct: 70  TSLGLGVKNMDNLKETFAHLSELHCDKLHVDPENFKLLGNMLVIVLSSYFGKEFTAEAQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           A  K +      ++ KY
Sbjct: 130 AWQKLVVGVATALSHKY 146


Go to top
>prf|0909303B|hemoglobin theta
          Length = 146

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 9   QMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCT 68
            ++  +WGKV  ++   G E +  L   +P T   FD F N+ S   +  +  +K HG  
Sbjct: 9   SVITGLWGKV--NVEETGGEAVGRLLVVYPWTQRFFDSFGNMSSPSAIMGNPKVKAHGKK 66

Query: 69  VLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADA 128
           VLT+ G  +K           L++ H  K  +  +    +  +I+ +L   + G+F  + 
Sbjct: 67  VLTSFGDAVKDMDNLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIILASHFGGEFTPEV 126

Query: 129 QGAMSKALELFRNDIAAKY 147
           Q A  K +      +A KY
Sbjct: 127 QAAWQKLVAGVATALAHKY 145


Go to top
>prf|2305272B|globin
          Length = 147

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E  ++ ++WGKV  ++   G E L  L   +P T   FD F NL S   +  +  +K HG
Sbjct: 8   EKAIITSLWGKV--NVEEDGGEALGRLLVVYPWTQRFFDTFGNLSSASAIMGNPKVKAHG 65

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VL++LG  +K           L++ H  +  +  +    +  V++ VL K +  +F  
Sbjct: 66  KKVLSSLGEAIKNMDDLKGTFSHLSELHCDRLHVDPENFRLLGNVLVIVLAKHFGKEFTP 125

Query: 127 DAQGAMSKALELFRNDIAAKY 147
             Q A  K +      +A KY
Sbjct: 126 QIQAACQKMVAGVATALAHKY 146


Go to top
>prf|1814374B|beta globin
          Length = 147

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E  ++ ++WGKV  ++   G E L  L   +P T   FD F NL S   +  +  +K HG
Sbjct: 8   EKAIITSLWGKV--NVEEDGGEALGRLLVVYPWTQRFFDTFGNLSSASAIMGNPKVKAHG 65

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VL++LG  +K           L++ H  +  +  +    +  V++ VL K +  +F  
Sbjct: 66  KKVLSSLGEAIKNMDDLKGTFSHLSELHCDRLHVDPENFRLLGNVLVIVLAKHFGKEFTP 125

Query: 127 DAQGAMSKALELFRNDIAAKY 147
             Q A  K +      +A KY
Sbjct: 126 QIQAACQKMVAGVATALAHKY 146


Go to top
>sp|P19760|HBG_GALCR Hemoglobin subunit gamma (Hemoglobin gamma
           chain) (Gamma-globin).
          Length = 147

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 7   EWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHG 66
           E  ++ ++WGKV  ++   G E L  L   +P T   FD F NL S   +  +  +K HG
Sbjct: 8   EKAIITSLWGKV--NVEEDGGEALGRLLVVYPWTQRFFDTFGNLSSASAIMGNPKVKAHG 65

Query: 67  CTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGA 126
             VL++LG  +K           L++ H  +  +  +    +  V++ VL K +  +F  
Sbjct: 66  KKVLSSLGEAIKNMDDLKGTFSHLSELHCDRLHVDPENFRLLGNVLVIVLAKHFGKEFTP 125

Query: 127 DAQGAMSKALELFRNDIAAKY 147
             Q A  K +      +A KY
Sbjct: 126 QIQAACQKMVAGVATALAHKY 146


Go to top
>tr|Q03903|Q03903_MACMU Gamma-globin-2(A) (Gamma-globin).
          Length = 147

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 2/137 (1%)

Query: 11  VLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVL 70
           + ++WGKV  + AG   E L  L   +P T   FD F NL S   +  +  +K HG  VL
Sbjct: 12  ITSLWGKVNVEDAG--GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVL 69

Query: 71  TALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQG 130
           T+LG  +K           L++ H  K  +  +    +  V++ VL   +  +F  + Q 
Sbjct: 70  TSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIYFGKEFTPEVQA 129

Query: 131 AMSKALELFRNDIAAKY 147
           +  K +    + ++++Y
Sbjct: 130 SWQKMVAGVASALSSRY 146


Go to top
>prf|742500A|hemoglobin alpha
          Length = 141

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 63/146 (43%), Gaps = 6/146 (4%)

Query: 3   LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDL 62
           L+D E + V  +WGK  G    +G E L  LF+A P T   F  F      +    S  +
Sbjct: 2   LTDAEKKEVTALWGKAAGHGEEYGAEALERLFQAFPTTKTYFSHF------DLSHGSAQI 55

Query: 63  KKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSG 122
           K HG  V  AL T         + +  L+  HA K ++     + ++  I+ VL +   G
Sbjct: 56  KAHGKKVADALSTAAGHFDDMDSALSALSDLHAHKLRVDPVNFKLLAHCILVVLARHCPG 115

Query: 123 DFGADAQGAMSKALELFRNDIAAKYK 148
           +F   A  AM K L      + +KY+
Sbjct: 116 EFTPSAHAAMDKFLSKVATVLTSKYR 141


Go to top
>tr|Q9PVL9|Q9PVL9_HYNRE Larval alpha-globin.
          Length = 142

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 6/148 (4%)

Query: 1   MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE 60
           M L+  +  +++++WGK+ G     G E L  +F++ P++   F  F      +    S 
Sbjct: 1   MTLTAADKALIVSLWGKIAGHTEALGAEALERMFESFPQSKTYFSHF------DLHHGSA 54

Query: 61  DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY 120
           D+K HG  VL A+G   +        +  L+  HA   ++     + +S  I  VL   +
Sbjct: 55  DVKSHGAKVLNAIGLAAQHVDDLDHALSKLSDLHAYNLRVDPGNFKLLSHTIQVVLANHF 114

Query: 121 SGDFGADAQGAMSKALELFRNDIAAKYK 148
             +F  +A  A  K L      + +KY+
Sbjct: 115 PAEFTPEAHAAFDKFLAAVSTVLTSKYR 142


Go to top
>sp|P01979|HBA_ORNAN Hemoglobin subunit alpha (Hemoglobin alpha
           chain) (Alpha-globin).
          Length = 141

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), P